Conserved Protein Domain Family
HNOBA

?
pfam07701: HNOBA 
Heme NO binding associated
The HNOBA domain is found associated with the HNOB domain and pfam00211 in soluble cyclases and signalling proteins. The HNOB domain is predicted to function as a heme-dependent sensor for gaseous ligands, and transduce diverse downstream signals, in both bacteria and animals.
Statistics
?
PSSM-Id: 336773
View PSSM: pfam07701
Aligned: 63 rows
Threshold Bit Score: 158.872
Threshold Setting Gi: 156382244
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52782815  221 ILVGLRDFKNIFPYHVCFNKQMIIEHIGIYLLREYgLENKKTLKVSDLMQLVQPSdIQLTYKNVLSYLNTlFIFQLKHHS 300
gi 514691103 203 VAMPPSLTNDLFPWHVAFDRDMKIASLGKHLASRL-KRKQIGAQAWQVFKVVRPSsMRLKFDDMLQVQGApILLSVDAKH 281
gi 514683898 203 vdlpASVTNDLFPWHVAFDRDMNIVSVGKHLAGRF-KKQQLGAKAGSVFKIIRPShVRLKFDELMQAKDVpVLLSVDAKH 281
gi 514683198 203 idLGKSVTNDLFPWHFAFDRDMKIVSLGKHLAARF-EEPQAGKPFKKVFRMLRPVdISSEFDELKDVDGVsCLFSVDAKL 281
gi 514700622  61 aQLNAGMTNRLFPWHFAVDKDMKIVSLGKHLASRM-KKDCIGMHAEKLFRIARPIdATWDFEDIKARCDKpFLFVTNPKR 139
gi 514700614 203 aQLNAGMTNRLFPWHFAVDKDMKIVSLGKHLASRM-KKDCIGMHAEKLFRIARPIdATWDFEDIKARCDKpFLFVTNPKR 281
gi 514700718 203 aqLDATMTNRLFPWHFAVDKDMRIISLGKHLASRM-KKDCVGMHADKLFRIARPIdATWDFEDMRARCDKpFLFVTNPKR 281
gi 167533895 205 VSMDSAAIDRLFPWHFAFDEELKIVSIGSQLRRHL-NANPIGSKLADIMAIQRPLeAKYRYDDFQQRSGNpYQLALHRDA 283
gi 167523324 187 LNLSPDTLDALFPWHLSFNRDFKVTSIGSNLAKRF-AKSCVGDSLDAIARVVRPYtIKFEFDKKSEWDGSqMVFAVVRDD 265
gi 514681518 204 LSADTGLFDELFPWHVQIDRKMRVVSMGSSLQTRFqDQKLDSLTFHDVFKLTQPNvPQKTFTTFMQFDHDaFVAIARDEQ 283
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52782815  301 KRNEVQE----------------------------------------GSSEA---------------------------- 312
gi 514691103 282 LThevtvdesvvtlthhlpqlqvtdpsgargsesst-------------------------------------------- 317
gi 514683898 282 LV-QPDS----------------------------------------SDDASvsdnadtsvsslsqqmprlqvtedsrgn 320
gi 514683198 282 LRdddahglasgmqgmslmgnggdmasdmrs------------------------------------------------- 312
gi 514700622 140 MLsaeeyaamlserqqrlaqedreqrhsnliqqfeqqssssqatsgrasartstql------------paaersgagslr 207
gi 514700614 282 MLsaeeyaamlserqqrlaqedreqrhsnliqqferqsidahaqekeaadds---------------------arlnvpr 340
gi 514700718 282 MLsaeeysamlterhqqrqlhllkqtnrahleeaetakevqlpsmvdvskphvrlvvneaaeedrnepdadaqsqtdeer 361
gi 167533895 284 QADIQIA----------------------------------------SHYAAtddnsdacsvaaselsnvgcpfsg---- 319
gi 167523324 266 AARDEPV----------------------------------------SMKCPvtgrtyeltgaa---------------- 289
gi 514681518 284 YHMKKEQ----------------------------------------KHMAKlraraaehgwdddddall---------- 313
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52782815  313 ------------------------------------------FQQPLVLKGEMMPINDGNSIIFICSPHVTTVRDILNLK 350
gi 514691103 318 ---------gcpfsgtsssfssntsskrssadmllraarltsKVDNIKLHGQITYHEESDLLLFVGVPALHSLEEMEAQG 388
gi 514683898 321 qrrstaamsacpfsspgsainstasskrssmdmmlraarlarKVDNIKLHGQVTFHEASGVLLFVGVPALYSLEEMETQG 400
gi 514683198 313 --------------slvscassfrgsnasssdmlmmanrlyaKADNIKLHGQLTYNSDHDVVVFFGTPALRSLEEMEAQR 378
gi 514700622 208 psgcpmtgmrhsqssattastsagtsarssmdllearsrhlkKASHIKLHGEVVFDEDKQVLLFVGNPFVQSMEELEAQG 287
gi 514700614 341 fsgfsgcpmtgrtpsghtsattsaahslrssmdahdiraralRTNNIKLHGEVVFDEEQQVLLFVGNPLVQSTEELDTQG 420
gi 514700718 362 slvcpmsrrfdalsapslantsgstsrrssldaleqnsryirKPTHIKLHGEIVYDEAKQVLLFVGNPLVQSLEELNKQG 441
gi 167533895 320 ------------------grrrsdesaissidrmqalrnmpqRI--IQLHGEFVALQEGQ-LFFAGAPLLRDVKQLDAQG 378
gi 167523324 290 -------------------------------aeryrrvgvanLKGHLFLKGEVRYEQEMDVMVFVGTPHLSNLEELKTYD 338
gi 514681518 314 -------------------------qrtvscssvegesfisvATDYLYIKGEMIYISKTDTILFAGVPQFSKPEEMYLRG 368
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 52782815  351 LYISDMPMHDATRDLVMLNQSRICQMELNKKLEETMKKMKKMTEELEVKKSQTDRLLFEFVPPVIAEAL 419
gi 514691103 389 INLTELPLHSHGREFLYGAMYQSASAKNTNEVDKRMAELDHSMLEVQQKKEQIDALLHSILPPVVASSL 457
gi 514683898 401 ISLSEMPLHSHGREVLYGSMFQSASAKNTNEVDKRMAELDRSMLEVQEKKEQIDTLLHSILPPVVASAL 469
gi 514683198 379 IELSEMPLHSHGREFLYGSMFQSASAKNSNEVDRRMAELDQSMLEIQDKKKQIDGLLHSILPPVVASSL 447
gi 514700622 288 IDLTDLPVHSHGREVLYGSMCQAISASNSNDVEAKLADLDRSMAEVHSKKEQIDGLLHSILPPVVADSL 356
gi 514700614 421 IDLADMPIHCHGREVLYSAMCQAVSASNSNEVEAKLADLDRSMAEVHSKKEQIDGLLHSILPPVVADSL 489
gi 514700718 442 IDLADMPIHCHGREVLYSAMCQAVSASNSNQVEAKLADLDRSMIEVQEKKEQIDALLSSILPENVANAL 510
gi 167533895 379 ITMSDLPVHSHASEILYASMFQAMSAKRANKADKELLMLNNNRDEVRRQQEITANLLHSILPPRIADAL 447
gi 167523324 339 IDLVELPVHSNARDMVFAQQHSSATIGMAKELEVLTRELEVERENVNREKMRIHELLYSILPPTIADSL 407
gi 514681518 369 LSLADIPIHSNGREILFSTAHQAATVSIAAELEQTTSDLSRAQQEVTHEKHRVQELLHSILPKQVAQCL 437
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap