Conserved Protein Domain Family
UTRA

?
pfam07702: UTRA 
Click on image for an interactive view with Cn3D
UTRA domain
The UbiC transcription regulator-associated (UTRA) domain is a conserved ligand-binding domain that has a similar fold to pfam04345. It is believed to modulate activity of bacterial transcription factors in response to binding small molecules.
Statistics
?
PSSM-Id: 311574
View PSSM: pfam07702
Aligned: 152 rows
Threshold Bit Score: 79.5599
Threshold Setting Gi: 81722357
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IKK_A       25 STGKKPKHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQPLTFEVTHYPLDLFPGIDTFIAdGVSXHDILKQq 104
gi 81783687  90 AQGRQPRTETLHAERRAAGAWLAKRMGLEDSAPVYFLQRRRWVDERPVLIELIALDAGWCPGLLDHDL-DTSLMSLLREr 168
gi 81726384  86 AQNRVPKTELIAAKGTLANKQSARLLQLQPFSDVFRVDRVRYLEDRPVVYVTNYIRPEIFPNLLSFDL-TNSLTDIYREh 164
gi 81788360  86 AQNRQPKTELVSAKAVIANKQATRLLKLKPFSDVYRVDRVRYLDNRPVVYVTNYIRPELFPNLLDFDL-SQSLTDLYREh 164
gi 81726284  96 EQHRIAATQLISVRSEMAAGDYAKALDIEQMTPIHIIERLRCIDGRAVLFVENVLKASLFDGILAENL-TMSLTGIYREk 174
gi 81733455  92 DQGRVASTELLSARLQPASAAICARLQLPALSSVVRVCRLRRIDGRAVLYAEHYLNPRYFPGILEHDL-AQSLTEIYGRv 170
gi 81783821  92 DQGRVPETEVLGAAMIPASVDICQRLELPALSRVFQIRRARRVDGRLVLYVEHYLNPAYFPGIERFDL-TRSLTDLYANh 170
gi 81783663  92 EQGRVPATEVLSARQMPASAAVCELLELPALSSVYQIRRARRVDGRLVLYVEHYLNAQYFPGILGHDL-TRSLTELYASe 170
gi 81730143  92 AQGRVAHTQLLSARLQPASAMICEMLELPALSSVIQICRARRIDQRLVLYVEHYLRPELFPGILDHDL-NESLIELYARc 170
gi 81706925  94 EQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDL-NGSLTEVYESh 172
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
2IKK_A      105 YKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEIDKTAFTSNDQPIYCSLFLXHTNRVT 165
gi 81783687 169 FGLQPTRCQLAMHPTALNAAQAEPLQLAPGSPALYLERLSYAEGQRVVEFDQEFWRPDALE 229
gi 81726384 165 FGVVYQKTRYRISTSTLLGEVAQALRATSGTPAMVVERTNYNQHGELIDCDIEYWRHDAIS 225
gi 81788360 165 YATQYQTIHYRISTSSLLGEMAQALRATSGTPAMVVERVNYNQKGELIDCDIEYWRHDAIT 225
gi 81726284 175 YGYETMRSRFDVIPTSAPAHVAKALNLAEGQPVLKICRVNYKQDGELMDCELEYWRPDAVM 235
gi 81733455 171 YGIEYGQVCFEILPTALPVEAASALKVSAGSPGLHITRVNSDQHGHLIDCDLEYWRHDAIR 231
gi 81783821 171 YGIRYGRVRFEMVPTILPAEAAGPLRVSVGSPALQIVRVNRDQAGRLIDCDLEYWRHDALQ 231
gi 81783663 171 YGIHYGRVRFDMVPTALHAEAAAPLKVAVGSPALRISRINRDQRGRLIDCDLEFWRHDAIH 231
gi 81730143 171 YDVHYGPVRFDVVPTALHADAAAALKVSLGSPGLRIARVNYDRKDRLIDCDLEYWRHDAIH 231
gi 81706925 173 YNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDLDIEYWRHDSLR 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap