5A1U


Conserved Protein Domain Family
Coatamer_beta_C

?
pfam07718: Coatamer_beta_C 
Click on image for an interactive view with Cn3D
Coatomer beta C-terminal region
This family is found at the C-terminus of the coatamer beta subunit proteins (Beta-coat proteins). This C-terminal domain probably adapts the function of the N-terminal pfam01602 domain.
Statistics
?
PSSM-Id: 311587
View PSSM: pfam07718
Aligned: 94 rows
Threshold Bit Score: 93.7708
Threshold Setting Gi: 585190479
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A1U_G        687 SFMQLTAKNemnc-------kedqFQLSLLAAmgntq----rkeaADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDI 754
gi 124464107  642 IIRQLKGVS---------------EFNEIDLAddetsv--atkqeENTYV-SRLGHIVQLTGYCDPIYAEAFVNVHKYDI 703
gi 122120622  696 VIRALKGKQaeig-------dldlQDEEINQIefkg------vgeDNDFA-SKLNKLVQLTGYSDPIYAESFVYIHKYDI 761
gi 122113809  697 MFTQIMEGKgsll--------eleAVDDLGSVvana-----siekTEEFL-IKLEKTVPLSGFCDPLYCEASVTVHQFDI 762
gi 122125299  694 IFTQLAQGKdafl--------eleATDDLGSAiana-----sidkTEEFL-KRLEKTIPLSGFCDPVYCEASVTVHQFDV 759
gi 209877382  712 NFRQLKEKVmlsgy------dllqVEDDIDQYedpfkictknpnnTDIIDcNSLKRIYPITGLDDPVYIEVIVQVQQHDV 785
gi 154416164  635 SFSSLLGRKfdq---------agpAAANAKNAslk-------iqeETQEE-KSKKSLVVLSGTCDPIFSECTMKPGKFDI 697
gi 146085421  707 VFSQLSEGKdavf--------eleATAEGPGAaakge---gserkAQLFL-KKLEDTMPLSGFNDPVYCEASITVHQFDV 774
gi 855315351  668 VFKQLRDKSslgim------ididdNAAVEKAtef--------dkEMTYN-EKLNRVHQLTGYSDPVYCESVVYMKDFDI 732
gi 74971043    90 NFEQMKLKYslnndilydynefkyPAINQDNY-------------SSTFL-SKLHKSQAITSIDDDIFIEIFPIISSINL 155
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
5A1U_G        755 VLDVLVVNQTSDTLQNCTLELATLGD--LKLVEKPSPLT-LAPHDFANIKANVKVASTENGIIFGNIVYDV 822
gi 124464107  704 QFEVLMVNRWSKMVQNVQVEFRTQGE--SKVIEKAQGVI-LQPNQSARVRTTIKFSSQDIGVVYGAIHYEN 771
gi 122120622  762 QFETLLINRTTKPLQKVQIEFFTQENdqKRVIEKAQAVT-LQPNQSAYVKTSLKFTSIDIGVIFGAINYEN 831
gi 122113809  763 TVDWYIANCTANVLRDVSIELTPLGS--MKLCERPQVHT-IQPHGSVRIRTALKVGSPETGVICASVLYEG 830
gi 122125299  760 SVDWYLVNKTSNLMQELTIELASLGG--MKLCERPQVHS-LPPHGSLKLRTALKVSSTETGVIYASVLYDA 827
gi 209877382  786 LLELIIMNRANTALQNIQIEIYPYGN--LQIVEKPQNINhLDPSEVVHLYSTVQVQSIETGILFGFVTFQl 854
gi 154416164  698 LLEINLLNQTLSNLLNVKVELYCSGK--LELVDKPSTIT-LPAQQSDQIICSIKATSAEAGRIYGNILYDI 765
gi 146085421  775 SVDWLLVNCTSKQLTNLTIELVSLGG--MKLCERPQTYT-LNPHETIAVRTSLKVSATESGVIYGTVLYDA 842
gi 855315351  733 IMEITVINRTNRTMTDLAVELSVTGS--FSIIDKPGRIT-LDAGERRELRAIIKVNSTETGYIFGSITFSY 800
gi 74971043   156 ILEFYIYNQSGIYLQNIFINLSTHNN--LKPIDKIPQFN-LAPHEKKKFKTTIKVHTTETGTIFGYSFYEK 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap