Conserved Protein Domain Family
TPR_2

?
pfam07719: TPR_2 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by pfam00515.
Statistics
?
PSSM-Id: 311588
View PSSM: pfam07719
Aligned: 362 rows
Threshold Bit Score: 26.7248
Threshold Setting Gi: 887407915
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|....
2V5F_A         46 VSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEH 79
gi 122114513    7 AEDCVERAVKYLAEGKIEKAEKLLNKSITLHRTE 40
gi 205816200  144 AMLLCNKSNAFYNLGKWNEAFLAAKECLQWDPTY 177
gi 75261962   123 ATLYSNRSLCYLQIGKAQKALLDAKKCVKLRPKW 156
gi 75145564    38 AIYLANRAAAALKLQRFQDVVRDASQALDLNPGY 71
gi 68053332    75 KKVIWRRGLAYLRLGHPHLANRDWEHSLELDPNN 108
gi 81817959    53 AADHFTRAQGYMRLGYWDDAIAELDDAIAFNPGE 86
gi 81844947    29 PGVLLCRGQLYLKTKRLEEAESDFRQLLRLNCGP 62
gi 74881887   198 SDLYCNRGITHYKKKKYIKCLDDCKKAFSFNNKK 231
gi 667106045   14 PEALRDRGMAYLHLGHRNGARHDLSRYLVLNPGA 47
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap