3EHF


Conserved Protein Domain Family
HisKA_3

?
pfam07730: HisKA_3 
Click on image for an interactive view with Cn3D
Histidine kinase
This is the dimerization and phosphoacceptor domain of a sub-family of histidine kinases. It shares sequence similarity with pfam00512 and pfam07536.
Statistics
?
PSSM-Id: 336787
View PSSM: pfam07730
Aligned: 171 rows
Threshold Bit Score: 30.2658
Threshold Setting Gi: 81858883
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
3EHF_A          6 ERQRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPE--QAARELKSVQQTARTSLNEVRKIVS 66
gi 81732685   467 EKARIAREVHDELGQMLTVLKLETSMCELAYADLDP--GLSERLDSMKRLISQLFQLVRDVAT 527
gi 75390683  1402 ERGRIARDLHDEFGHLFAGVMDGLSALQ---NSEDA--TTRQTATDVRTIVRQGIQVARTVAW 1459
gi 81506793   247 EKTRLARELHDELGALLTATKMDLHWLRSRITVSEP--AVADKITRVMAHVDQGIQIKRRLIE 307
gi 81506919   251 ERHRIARELHDDLGQRLSALKMDISLLAADLQAEGGdrTLIAQTEAMQRVIDETISAVRQISA 313
gi 75540350   289 ERTRIAREIHDDIGGTLTAIKCELVPCLDNSSRTPE--FYRNKAEAVESLVDMVIDSTRRIAL 349
gi 81757166   250 EKKHLARELHDGINQLLVSSKCHLELLAHKVQDP----SLKVHLDKSQQSLTTAINEVRHISH 308
gi 123738233  250 ERTRLARELHDGISQTLLGVRYAMDLAGRKVRTNVD--DAAQTIERGVEALNGAIKEIRLLSH 310
gi 123740925  250 ERARLARELHDGISQNLVGVRYAIDLASRQVRTGSG--GAPQTIEKASDALNGAIKEVRRLSH 310
gi 21311397   252 ERKHIAREIHDELGQHLTSMRMSLSLMRMQFARDNP--HMLTQLQNLMALSDKTIQVVRHVAT 312
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap