1COM,1ODE


Conserved Protein Domain Family
CM_1

?
pfam07736: CM_1 
Click on image for an interactive view with Cn3D
Chorismate mutase type I
Chorismate mutase EC:5.4.99.5 catalyzes the conversion of chorismate to prephenate in the pathway of tyrosine and phenylalanine biosynthesis. This enzyme is negatively regulated by tyrosine, tryptophan and phenylalanine.
Statistics
?
PSSM-Id: 336791
View PSSM: pfam07736
Aligned: 171 rows
Threshold Bit Score: 132.167
Threshold Setting Gi: 609234384
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1COM_A         4 RGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKP-EDVVQMLLSATPDLHAVFPAKAVRElSGWQYVPVTCMQEMDVT 82
gi 489611770   3 wAIRGATTVSDNTADEIVAETQKLLKEMAEKNGLEE-DDIISIIFTVTKDLDAAFPAIAARn-MGWTSTALMCMNEIDVP 80
gi 506405477   4 RAVRGAITVPENTKESIWEGTKELLVEIVNRNSLKN-ADIISAIFTVTHDLSAAFPAVAARQ-IGWNDIPLMCTNEIDVP 81
gi 504021048   3 RAIRGATTVENNDAVEILRETEKLLTEIYEKNKLKE-EDLISIIFTVTNDLNATFPAVAARn-LGWTSVALMCTNEIPVP 80
gi 505139974   4 RGIRGAITVEKNSSEQILSATQELLQELEETNDLKE-DNVASVIFSMTPDLDQAFPAQAARE-MGWNEVPLFCTQELAIE 81
gi 503043023   6 vAIRGAITVDKNTKEDILTSTQELLTEILERNQLDE-EDIISIFFTVTQDLDAAFPAQAARE-LGLDFIPLLCANEIDVP 83
gi 524772544   2 tAIRGATTVSVNAAEEIENAAAELIDEIMNRNFLGG-EDIVAIIFSCTKDLTAAYPAKGAREkSGLNKVPMFCVQEQYVV 80
gi 524762070   4 KGIRGAITVDENSVEAIKDAALELLNSMIAENNIDV-SMISHVIFTLTNDLNAAFPAKFARLeLGWTETAMMCFHELDVP 82
gi 524803011   4 KGIRGAITVDSNTEEAIEKATLELLNEIWERNHLEGtSQISHVIFTTTPDLNAAFPAKYPRIaLGWNDVAMMCFHELDVP 83
gi 524180241   4 KGIRGAITVEENSPEAIGAATIKLLTEMVRKNNIEI-DSISHAIFTLTNDLNADFPAKYARVnLKWKNVPMMCFNELDVP 82
                         90       100       110
                 ....*....|....*....|....*....|....*..
1COM_A        83 GGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRPDL 119
gi 489611770  81 GSLEKCIRVMMHVNTDKDKKDIKHVYLNGAKVLRPDL 117
gi 506405477  82 GSLEKCVRVLIHINTEKTNAEINHVYLNGAAVLRPDL 118
gi 504021048  81 GSLEKCIRVLMHINTDKRNDEIKHIYLNNAKVLRPDI 117
gi 505139974  82 GALAKCIRILIHYNTEKALTEINHIYLKAAKELRPDL 118
gi 503043023  84 GAISKCVRILIHINAGEKLEEVEHIYLKDAKKLRPDL 120
gi 524772544  81 GAVDKCIRALVLCQ--KTIKDARHIYLKGAINLRSDL 115
gi 524762070  83 DSLEKCLRVLIVLNCGESF-KPKFVYLKGASILR--- 115
gi 524803011  84 NSLKMCLRVLVVINCEENF-NPQFVYLKDAEKLRK-- 117
gi 524180241  83 NSLQKCLRVLIVINCGEGF-VPEFVYLDGADVLRK-- 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap