Conserved Protein Domain Family
DUF1615

?
pfam07759: DUF1615 
Protein of unknown function (DUF1615)
This is a family of proteins of unknown function expressed by various bacterial species. Some members of this family are thought to be lipoproteins. Another member of this family is thought to be involved in photosynthesis.
Statistics
?
PSSM-Id: 311619
View PSSM: pfam07759
Aligned: 34 rows
Threshold Bit Score: 426.654
Threshold Setting Gi: 122309874
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81392630    52 RVHDRQSWANDINDIMEKLKIPKTKDNVCSVVAIVDQESNFVANPVVAGLGEKAVKEVSTRLNEKfeeklgttiggQVAG 131
gi 122309874   54 GVKDREGWAQAVLDALEAQKIAPTVEPICQVLAVIEQESGFQANPGVKDLPRIVRRRLDAYAGKL-----------GVIG 122
gi 122390243   41 QLQDREGWARDVLAALEVEEIAPSPPAVCSVLAVIEQESGYKVDPAVAGLPKMVRTRLEEHANKL-----------GPLG 109
gi 81656086   106 GIPDRKGWSNDVMGAFSHLKIPYTPQFFCAVLAVAEQESGFSPDPVVPNLSKIVWGEIEQRRQKY-----------LIPQ 174
gi 81654787    81 GARDRQGWIADIDGAFRHLQIPATADNACALAAVIEQESSWQADPVVPGLPKIVWGKIEERAHRY-----------LVPL 149
gi 644549877   60 RVKERDAWAVDISRIMDELKINKTQENVCSVIAVVDQESNFVANPTVPDLGNKAIKAFQTEVPQKfvrqfgpalgpAVSR 139
gi 504206428   54 kgAEREGWAGDVLAALDAEAIPAAASEVCQVLAIIEQESGFQADPAVPGLPKMVRQKLDSTAGRL-----------GPVG 122
gi 1035831887  44 RVNNAKLWATDISDIFDELSLPKTAQNICTAIAVIDQESNFHADPSVPNLGNAALKAIDDKLEDKlg--------kNMAG 115
gi 503854254   97 KIRDRAGWAEDIFDAFTALKLPYTAENFCAAAAVIEQESSWQSDPTVPGLPKIVWGKIGEKAAGY-----------HIPL 165
gi 502500122  130 gISERSAWAVDILTAFASLRIPALAENLCATIAIIAQESSFQADPPVPGLAHIVWQEIERRRERY-----------AIPK 198
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81392630   132 YFEDVLKNQPTPD---DNYMSQMRRVRTEKDLDVLYRQIF----------------DYMashyhvs--altgaakLVGQD 190
gi 122309874  123 RSALKALLQHKAPgesRTFEKRLKGVRTEQDLDRFFRDLL----------------EAYerhypafysaadlaseLFTSK 186
gi 122390243  110 RKVLASVLEGRAKgskKTFDERLRALRTERDLDRLFRDML----------------AYYenefpsafkvvdfasgVFASG 173
gi 81656086   175 FVVDAAMGKKSPDg--RTFKQRVDALRTKREMNALYEDMV----------------REL----------------PFGQT 220
gi 81654787   150 TVVKGALLKTSPNg--QSYKTRIDNLRTEREMNLLYEDMS----------------REAq---------------KLGLP 196
gi 644549877  140 YFTSVLVNEPSKE---NSFLIQMRTVKTEQQLDLIYRQIF----------------AYVskqfyads-itnaaakFMGKD 199
gi 504206428  123 RRLLGDVLAAKPKgakRTFGARLDTLRTERDLDRLFRDMLayyeeeypaayaaadlASS----------------LFGPS 186
gi 1035831887 116 VFRNMLETRPTPK---NNFIKQIKAVKTEKQLDELYREIF----------------DYFtktykia--pltnitkLSGQG 174
gi 503854254  166 PLVKTALLKPSPNg--RSYKERIDTLRTEKQMNELYEDMS----------------AEAe---------------KIGFP 212
gi 502500122  199 VVLDLALLKSSPDg--RTYRARIDALRTEKQMNALYEEMI----------------SEL----------------PAGRM 244
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81392630   191 IAEKMNPITTLGSMQVNIVYAKENKRvkLQSVNN---LRDDLYTQYGGLYYGIHRLMLYQTSYDKPIYRFADYNSGMYSS 267
gi 122309874  187 RLAELNPITTAGSMQVSVRYAVEQDDgeHSEQE----VREQLYTRAGGVHHGTSRLLGYPAGYPQPVFRFADYNAGFYAS 262
gi 122390243  174 NLHEFNPVTTAGSMQVSVRYAMQKAGedADPAE----VRESMYTRAGGVRYGTARLLGYEAAYPEPLFRFADYNAGVYAS 249
gi 81656086   221 IFEHKNPIRDGGPMQVSVAFAETHIRawPYPYNys-sLRDEVFGRRGSVYFGTAILLQYPAPYHEMVYRFADYNAGRYAS 299
gi 81654787   197 M-EMKNPIRTGGPMQVSVEFAEGHARvwPYPYPVqgsIRHEVFSRRGGVYFGAAILLQYPAPYRDMLYRFADFNAGRYSS 275
gi 644549877  200 IGEDNNPITTIGSMQVSVKYAREHQRd-NAPVNE---LRDYMYTREGGLYYGIHRLMKYPAAYDNAQYRFADYNSGMYSS 275
gi 504206428  187 SFAGQNPVTTAGSMQVSVRYAVEKAGpdADPVA----VRESLYTRAGGVRYGTARLLGFEAAYDAPLYRFADYNSGVYSS 262
gi 1035831887 175 IDERINPVTTLGSMQVHIDYARAHRRa-SMSdr---dLRADLYTRYGGLYYGIHRLMVYQANYDKPLYRFADYNSGMYSS 250
gi 503854254  213 TIMKKNPIRTGGPMQVSVEFAEAHVRawPYPYSRktsLRNEVFSRRGGVYFGSAILLQYPAPYKDMLYRFADFNAGRYSS 292
gi 502500122  245 LLGGYNPVRTGGPMQVSVTFAEEQVRnrPYPYTRrdsIRDQVFTRRGGVYFGVAMLLDYPAAYSQMLYRFADFNAGRYSS 324
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81392630   268 RNAALQSMLNKLGDEQLTEDGDLLLYNkd----gSiqSTRSSSEKALIKIFTL--Nn-vL--LTPNQIRTDLKQEKSQSF 338
gi 122309874  263 RNAALQAQLSRLTGRRLLLDGDLLLYNdq----gKprDEDSQSLSALLAFRQR--Ha-pK--LSERQLRKDVRKEKEASF 333
gi 122390243  250 RNAALQSQVSRLTGHPLAPDGDLQLYDkq----gQprSEDSKSLLALLAFRQR--FapeE--LSERQVRRDVRKEKEPDF 321
gi 81656086   300 RNAAFQLAVSRLSGRKLALDGDIMLYSdkmnrvlS--GETSDTQRALQSIAGR--L---G--ISDADMMRDLRLEKLSGF 370
gi 81654787   276 RNAAFQAALSRLSGRKLALDGDLLNYQ-------G--KAASGSQQAALSLAGR--L---G--MSAAAIQRDLQLEKNAAF 339
gi 644549877  276 RNAAFQQDINKLLNTDMALDGDLLLYDkdd--kaQ--SMPSQTETALNQLFAD--H---GmpMKPEQIRADLLQEKQAEF 346
gi 504206428  263 RNAALQAQVSRLTGVALATDGDLQLYDkd----gEprGEDSQSLKALLLFRER--Ya-pD--LSERRVRRDVKEEKTADL 333
gi 1035831887 251 RNAAFQQRIATLSGESLAIDGDLLLYKdg----sPi-SKISATETAAIALLATasK---P--INAQQIRSDFKKEKTRDF 320
gi 503854254  293 RNAAFQAVISRLSGRRLARDGDLLSYEn-----gQ--ASGGSTLNALQALDNR--L---G--MSDNAIMRDLKQEKLATF 358
gi 502500122  325 RNAAFQSSVARLSGSPLALDGDLLRYSdg---spA--AEASDTQRAIQSLRVR--L---N--LSEAEILRDLKLEKSFAF 392
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 81392630   339 EQTPTYIAITKLYQKQTGKEAPYAMMPQVIISGPKLSRDYNTNWYASRVNGRYQTCMQR 397
gi 122309874  334 EKTETWRALKQAYERVTGERPAYARLPEVTLQSPKLSRERTTAWFAHSVDQRFQRCLAR 392
gi 122390243  322 ESTDTFRAVKRVYQRETGESPSYAQLPRVTLQSPKLKRELTTAWFARSVDQRFQKCMTR 380
gi 81656086   371 GQSPLYQKVFALA----GPKAPREIIPQIVLVSPKFTHKLTTEWFARRVDGRYQRCLQR 425
gi 81654787   340 GQTPLYRQVFALADKQAGQAQPRERMPQIDLKSPKISRKLTTEWFAKRVDGRYRQCLAR 398
gi 644549877  347 ENTSTYQNVITLYKQQFGKNPPYAIMPQVVISGPKLSKDYNTNWYATNVTRRYETCMrh 405
gi 504206428  334 EKTDTYLAVKRVYANRMGQAPAYAQLPQVTLKSVKLSGERSTAWFAKSVDARYQQCMAR 392
gi 1035831887 321 EKTITYRAVNDMFASKFGRNPTYAIMPKVVISGPKLSRDFDTNWFATRVNERYQTCITt 379
gi 503854254  359 GQTELYRKVYALADPLYGGQAPREQLPQIDLKSPKITRKLTTEWFAERVNGRYQTCLQR 417
gi 502500122  393 EQTPLYQRLYALADAAGAGKRPRELLPRIDLKSPKISRRLTTEWFARRVDERYRNCLER 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap