Conserved Protein Domain Family
Omega_Repress

?
pfam07764: Omega_Repress 
Click on image for an interactive view with Cn3D
Omega Transcriptional Repressor
The omega transcriptional repressor regulates expression of involved in copy number control and stable maintenance of plasmids. The omega protein belongs to the structural superfamily of MetJ/Arc repressors featuring a ribbon-helix-helix DNA-binding motif with the beta-ribbon located in and recognising the major groove of operator DNA.
Statistics
?
PSSM-Id: 311623
View PSSM: pfam07764
Aligned: 3 rows
Threshold Bit Score: 117.849
Threshold Setting Gi: 446449463
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
1IRQ_A        1 MivGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL 71
gi 446449463  1 M--GNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL 69
gi 909706158  1 MivGNLGAQKEKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMEIRLRSKLKSVLIVQY 71
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap