Conserved Protein Domain Family
DC_STAMP

?
pfam07782: DC_STAMP 
DC-STAMP-like protein
This is a family of sequences which are similar to a region of the dendritic cell-specific transmembrane protein (DC-STAMP). This is thought to be a novel receptor protein that shares no identity with other multimembrane-spanning proteins. It is thought to have seven putative transmembrane regions, two of which are found in the region featured in this family. DC-STAMP is also described as having potential N-linked glycosylation sites and a potential phosphorylation site for PKC, but these are not conserved throughout the family.
Statistics
?
PSSM-Id: 336809
View PSSM: pfam07782
Aligned: 127 rows
Threshold Bit Score: 79.1713
Threshold Setting Gi: 532079323
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956056  446 FKNRFLTKEFTKIDQDCAFRGARKVMPLMANESKQYVSRGQWKMTEQERPKFRLDIFITIVSCVTPFFMCMLDYGIFTTL 525
gi 556947696  207 YDNIYITKNLEDLA------QKNNTVDILSSCSRKIIKSMGLKMSHQEVLGCLFRMLLISIYLFLTLIIIATDHILFYVI 280
gi 765126093  260 FDNGYISKEL--------LQNEPCE---TKRSIRDKTKLGSCLMTNQECTSSFLSLIVVTLYFTAIALIVVLDYVVYYIV 328
gi 1033401347 278 FDNIYITKKLEYLAQERK------TIHLLSCTSRKLIKPTGLKLTREELMTSLTHIFLLTLVLILTLVIIATDYIAFHLA 351
gi 973193051  262 FDNVYITRQLERLARR----NGIEILP---GDAKKLISSRGCRMSQQEFLRCVPYLLVITSYLILTLVVIAVDHMVFHFI 334
gi 1025187295 254 FDNTYITGGLRR-------KGAEKGIVVEAKDVKNGVNSTSFRITKKELFKCLAPAMVITLYLLMTVFLIVLDFFLYYLV 326
gi 1043408461 241 FDNLYITEKLEKLALEKD------GSHLLTASRVKLIRSTGLKLSRREIFHCIIRSLILVSFVMFTTVVIATDHITYQFA 314
gi 47229136   237 sllylksylssvqfgssskelhkesagdsaarPRCPVSYPRCGIRSHERSSCVIALLVVTLYFLAITLTVILDYVVYRVV 316
gi 542216458  260 FDNGYISKELLQ------------KMPINERPAKNKINLENCKVISQECSSCFLSLIVVTLYFIAITLIVVLDHVVYYIV 327
gi 565314119  237 FDNIYITPKLEDLAREN------KTADVLICTSRKLIKPTSFKLSQKELKASLRHVFLLTLVLVVMLLVIAADYIAFHLA 310
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956056  526 STVHTLMnr-tNIDTPAHYELKVA---------------GNSSMSDVMNE-----FLDv----------FS-------Pf 567
gi 556947696  281 RTIADWVfdfpTVPMDVTVNYNVK---------------VVSF--PIPLK-----EAVs----------F--------Q- 319
gi 765126093  329 QLVMPWVvdfpPTAASISLNYKVE---------------LFVPVLCLIPSscvtqTLTn----------FH-------R- 375
gi 1033401347 352 QAAVSEAtqfpVVPISFWIKYDVStkatspktnsllffqVKLTFIEFFGK-----VFNnafsieqskspFE-------R- 418
gi 973193051  335 VAGGLWLsgdpYVTATIDVKYTVR---------------RITPICSLFHS-----SCDee-------ilRH-------Q- 379
gi 1025187295 327 KTGGPWIsnmpSTNISINVNFKVG---------------TEVAICQILSS-----DCQlel------fnFN-------R- 372
gi 1043408461 315 LTVGEWVvkvpSVPIVFEIDYLIT---------------YNHG---------------------------N-------S- 344
gi 47229136   317 DLILPWLldfpSTSAIFDVRYELK------------------TFAPFLCL-----IPSa----------CRnwkpinfH- 362
gi 542216458  328 QMIAPWLldfpPTSAVI--SVNY-----------------------KVQW-----FPPa---------fCI-------Ip 361
gi 565314119  311 QTVVTEVtripVVPVTF--WVKYE---------------IQPFLLVLf-------------------------------- 341
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956056  568 ------------TKSIrdR-ENRWRRCFNE-P-NPPNYTENMVMFLMFIAALFLCRLKAYFGRQTLVLADYFFPNRVRIR 632
gi 556947696  320 ------------KDYHw-N-FPFFTGCTMK-A-SPPNNSVAFVIGLLYLIAYIMVFLEAYASRLRRKIAASFFEHQECQR 383
gi 765126093  376 ------------DYRWd-F-NPEPSNCAVT-T-SAPNGGVTFLLGCLWLMSYFMVFLEVYAKRLCRKICASFYREQEERR 439
gi 1033401347 419 ------------SYYQn-L-TFLSANCSLRyP-KPPNTAVTFAVGLLYCIIYAITFLETYSRRLCRKIAASFFKNQEDQR 483
gi 973193051  380 ------------KPYHwsF-NLVPGRCVIE-P-SKPDSGVVLQLGLLYLMAYILVVFEVYIRRVRRRVSASFFKRQEERR 444
gi 1025187295 373 ------------TYTAl-I-HSDPNVCEAQ-S-SKLNPSVVTALVFLYLFSYTLLPLEVYARRLRRKVAASFFQQQEERR 436
gi 1043408461 345 ------------RSFHwnM-TFVSSQCRTQ-A-TPPDDSVAITVVIICGVIFAMILMEAYAQRLCRKISASFYKQREDQR 409
gi 47229136   363 ------------RKYMw-TyNPEPSLCEAT-A-SPPSRGVCVLLGCLCVMSYFLVFLEVYAKRLCRKICASFFREQEKKR 427
gi 542216458  362 qscikrelvnfhRDYKwnF-SPGPSLCDVT-T-SAPNLGVTLLLGCLWLMSYFLVFLEVYARRLRRKISASFFRKQEEKR 438
gi 565314119  342 -----------eRNYHqnL-TFVSSKCFMQ-MpNPPNTALVLAVVLLFCIIYATVFLEAYSHRLCRKISASFFENQENQR 408

                  ....*
gi 121956056  633 ALSLY 637
gi 556947696  384 VDYLY 388
gi 765126093  440 MTYLR 444
gi 1033401347 484 IQYLY 488
gi 973193051  445 IVFLY 449
gi 1025187295 437 VEFLi 441
gi 1043408461 410 VSYLf 414
gi 47229136   428 MEHLR 432
gi 542216458  439 IAYLm 443
gi 565314119  409 IQYLY 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap