Conserved Protein Domain Family
DC_STAMP

?
pfam07782: DC_STAMP 
DC-STAMP-like protein
This is a family of sequences which are similar to a region of the dendritic cell-specific transmembrane protein (DC-STAMP). This is thought to be a novel receptor protein that shares no identity with other multimembrane-spanning proteins. It is thought to have seven putative transmembrane regions, two of which are found in the region featured in this family. DC-STAMP is also described as having potential N-linked glycosylation sites and a potential phosphorylation site for PKC, but these are not conserved throughout the family.
Statistics
?
PSSM-Id: 311636
View PSSM: pfam07782
Aligned: 126 rows
Threshold Bit Score: 78.021
Threshold Setting Gi: 532079323
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956056  446 FKNRFLTKEFTKIDQDCAFRGARKVMPLMANESKQYVSRGQWKMTEQERPKFRLDIFITIVSCVTPFFMCMLDYG-IFTT 524
gi 765126093  260 FDNGYISKEL--------LQNEPCE---TKRSIRDKTKLGSCLMTNQECTSSFLSLIVVTLYFTAIALIVVLDYV-VYYI 327
gi 973193051  262 FDNVYITRQLERLARR----NGIEILP---GDAKKLISSRGCRMSQQEFLRCVPYLLVITSYLILTLVVIAVDHM-VFHF 333
gi 1025187295 254 FDNTYITGGLRR-------KGAEKGIVVEAKDVKNGVNSTSFRITKKELFKCLAPAMVITLYLLMTVFLIVLDFF-LYYL 325
gi 1043408461 241 FDNLYITEKLEKLALEKD------GSHLLTASRVKLIRSTGLKLSRREIFHCIIRSLILVSFVMFTTVVIATDHI-TYQF 313
gi 47229136   237 sllylksylssvqfgssskelhkesagdsaarPRCPVSYPRCGIRSHERSSCVIALLVVTLYFLAITLTVILDYV-VYRV 315
gi 542216458  260 FDNGYISKELLQ------------KMPINERPAKNKINLENCKVISQECSSCFLSLIVVTLYFIAITLIVVLDHV-VYYI 326
gi 1020964612 266 FDNFYITKKLERLATDR------RAAHLLVGSSKKLIRPTGLRLSWEEVALCLVRAMLVTVALMLMLVLVAMDHF-AFSV 338
gi 823471139  203 FDNFYITKKLECLAADK------RAAHLLVGSSKKLIRPTGLKLSREEVVLCLVQAMLVTVALMLMLVVVAMDHF-AFSV 275
gi 483516970  249 FDNFYITKKLERLAVDR------KTPHLLGGSSKNLIRPTGLKLSREEVLLCLVQALRLTVALTLMLVVVAMDHVaX-XM 321
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121956056  525 LSTVHTLMnr-tNIDTPAHYELKVAGNSSMSDVMNE-----FLDv----FS-------Pf------------TKSIrdR- 574
gi 765126093  328 VQLVMPWVvdfpPTAASISLNYKVELFVPVLCLIPSscvtqTLTn----FH-------R-------------DYRWd-F- 381
gi 973193051  334 IVAGGLWLsgdpYVTATIDVKYTVRRITPICSLFHS-----SCDee-ilRH-------Q-------------KPYHwsF- 386
gi 1025187295 326 VKTGGPWIsnmpSTNISINVNFKVGTEVAICQILSS-----DCQlelfnFN-------R-------------TYTAl-I- 378
gi 1043408461 314 ALTVGEWVvkvpSVPIVFEIDYLITYNHG---------------------N-------S-------------RSFHwnM- 351
gi 47229136   316 VDLILPWLldfpSTSAIFDVRYELK---TFAPFLCL-----IPSa----CRnwkpinfH-------------RKYMw-Ty 369
gi 542216458  327 VQMIAPWLldfpPTSAVI--SVNY--------KVQW-----FPPa---fCI-------IpqscikrelvnfhRDYKwnF- 380
gi 1020964612 339 ADTAVRKAaqfsAVPVTL--NIRYkvEIGPVPFLFK-----IFRrpseel----------------llgdfnKTYHhhL- 394
gi 823471139  276 ADTAVRKAaqfsAVPVTL--SIKYkAEVGIMPFLFK-----IFWrpseal----------------llsdfnKTYHhhL- 331
gi 483516970  322 ADTAMRKVahlsVVPVTL--SIKYSAKIQLLPFILS-----LLQlpdies----------------tlrdfeKSYHhyL- 377
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 121956056  575 ENRWRRCFNEP-NPPNYTENMVMFLMFIAALFLCRLKAYFGRQTLVLADYFFPNRVRIRALSLY 637
gi 765126093  382 NPEPSNCAVTT-SAPNGGVTFLLGCLWLMSYFMVFLEVYAKRLCRKICASFYREQEERRMTYLR 444
gi 973193051  387 NLVPGRCVIEP-SKPDSGVVLQLGLLYLMAYILVVFEVYIRRVRRRVSASFFKRQEERRIVFLY 449
gi 1025187295 379 HSDPNVCEAQS-SKLNPSVVTALVFLYLFSYTLLPLEVYARRLRRKVAASFFQQQEERRVEFLi 441
gi 1043408461 352 TFVSSQCRTQA-TPPDDSVAITVVIICGVIFAMILMEAYAQRLCRKISASFYKQREDQRVSYLf 414
gi 47229136   370 NPEPSLCEATA-SPPSRGVCVLLGCLCVMSYFLVFLEVYAKRLCRKICASFFREQEKKRMEHLR 432
gi 542216458  381 SPGPSLCDVTT-SAPNLGVTLLLGCLWLMSYFLVFLEVYARRLRRKISASFFRKQEEKRIAYLm 443
gi 1020964612 395 VFSSARCRTSApTAPNRSVLLAVGLLFLLLYSTVLLETLARRLCRQIAASFFPSREQRRVLHLY 458
gi 823471139  332 IFSSARCRISPpTPPNPSVLLVVGLLFCILYGTVFLETYARRLCRSIAASFFQSWEEKRALHLY 395
gi 483516970  378 TFSSARCSISPpLPPNPSVLFVMVLLFCIIYATVFLETYARRLCRKIAASFFESREEERALYLY 441
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap