Conserved Protein Domain Family
DUF1629

?
pfam07791: DUF1629 
Protein of unknown function (DUF1629)
This family consists of sequences from hypothetical proteins thought to be expressed by two members of the Xanthomonas genus. The region in question is 125 amino acid residues long.
Statistics
?
PSSM-Id: 311641
View PSSM: pfam07791
Aligned: 5 rows
Threshold Bit Score: 151.867
Threshold Setting Gi: 500952303
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81794696   11 KGEFFHLQPDVRRGGKGHGVVFENRDALL--------TPPRLILKPKDGGFPALREIPRLVYHPSEG------VLPEDLE 76
gi 81794708   37 AGSFYMFEADMESNRQPCGVRFDNVRHLL--------SPPRLILRPEEGGFPTLRETPQLTYDPKTG------PAPRDLE 102
gi 500952303  12 prKYFALKPDFNATAKAPGHQWLNRTEQMvgfyphpdQPFRGI---------RFSKPPRIRFDRKRGrttlrdAAPFALS 82
gi 972293679  22 KGEFFLIDAGLLSNGGVPGIEIANEDKLI--------DPGMNVVSRPDGTPGQYPERPHLVHVPQKG------AMPRDLE 87
gi 500117711   9 KGEFYTLRPDLRGGGPGHGVVFENEKALR--------PPGRGMIRPPHGGFPPLREIPKLRYDSREG------LMPSDME 74
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 81794696   77 GGFSGYWLVSERLRRVMETVDPAAFAFADTDYRLAD-GSKGPNVYLCDVVRTVDALDE 133
gi 81794708  103 PGFSGYWLVSERLYDAMVLVDSDAFAFAEVDYRLAD-GTKGPRHFLCDIVRELDALGE 159
gi 500952303  83 S-----WLITDRLKLLFERLDPEAFVFQKVEVDYSNfPEAGPDYWLVYFMRMLDCVDE 135
gi 972293679  88 E-LAGIWIVSEPLKQLFEQMDPQAFAFVACDFSLAD-GSPGPQYYLGNVLRRLDALDE 143
gi 500117711  75 SGFSGYWLVSAALKEVFESVDAGGFAFQPCEFTLED-GSQGPDYFLCDVVRTLDALDE 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap