Conserved Protein Domain Family
DUF1631

?
pfam07793: DUF1631 
Protein of unknown function (DUF1631)
The members of this family are sequences derived from a group of hypothetical proteins expressed by certain bacterial species. The region concerned is approximately 440 amino acid residues in length.
Statistics
?
PSSM-Id: 311643
View PSSM: pfam07793
Aligned: 61 rows
Threshold Bit Score: 402.056
Threshold Setting Gi: 504826538
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691   17 DLPDHHSLAAQIRAIFETGFGQLLQDLFSRIDDELFKLADRADNSGLQTLYFDAMRQIRRDQAGMRSRCLREILEAEERF 96
gi 122479557  16 LRRPARHLLRSLIGKTLAFFVEREDDNLTRVREHLMDLLDARPSPVRAQNLRSARQLLHKQADVFNRAFQAALQTSMDEE 95
gi 504591242  22 MPEDARSILATCRDRLAQGVIAVFVKHLGRANDEFLGLADRAINLEQQQICFAAMHFIANRAQPLLDRFQKIYVAAFDAS 101
gi 491364112  23 ASADPASLLAACRDRIAHGLATVFAQHLDSANDDFLGMADRATSLEQQQLYFAAMDFLSGHGQLLLQQFRSAYVAQFESA 102
gi 505248641  15 PFRPHKGVLLECRDFVSQRVREALARAVGEVDAELQGRRGDATSGDESQRLIELQVLIRRVGADLDRAFSTGFDKQFQER 94
gi 551030371   6 SDRRHQALADKVRLRLVAELSQSMDTLAQRVRERLLELLDQPASSKDAQLRRDAWTLYQRHQALWCDATRRAWQAALQPT 85
gi 500135772   7 PSSAQRRLLRQARQMFVDGICAGLSELDQTLLDFLVELTQQAGTARQAQSRRDALMRYREFHGLWTERCARAWQEALIPH 86
gi 743533481  10 APAAPQQLGWQARLRWVHGICQGLPKVARQLDEFLSNQSSAVSTAKEMQEWREAWVGFQQNKDAWLQAGAQALQQAARKP 89
gi 120593123   4 SSQAPTAAFQSCVDEVLRQSAFLIDRWSSKLVSAMYERSLAVHEPAERHQIQAAIAVLKKNRLMFEQGFSAKLKKAIADD 83
gi 504829138   6 PSVPQRRLARQARQRFVEGICGGLADLDKTVQDFLTALMNQTGTAREMQSRRDAWLQYQQKHAAWTERTGKAWQEALAPH 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691   97 WNPADTPSAqpe--------dsGNPGLTLLENDVLEIELAVTHAAQKANLLFQDTLGPFELRLAALKgLQGPPLPPHPFT 168
gi 122479557  96 MRAVLPEAPasavandtsadplDGMTLSLIDVCEVERILLVDRVAQRFTAHYDASVSALTQRLGVLLgRDVAALSSNPFR 175
gi 504591242 102 VAGLGGERPrss--------prGLDELQLIDTEEFEQDLAIGKVSTRAAFNCSQQLVALDRRLAVLLrLQRIGQDENPLY 173
gi 491364112 103 VAALRGTTVeggr------asqEPRELSLIETDDFERDLAIAKLSARAACNCAQQLTALDRRFAALLhLSRITQDDNPLH 176
gi 505248641  95 AGAASPAGDfyqk------nngFFPELSLVEESVIDESLMVRNLSARLERNCEAESHDLQTRVAFMLgENDIDNTNNPIG 168
gi 551030371  86 PSTRSGPLAld-------------aGLQLVGTDVVENRILASRLALGVMEHAASEVNDLRKRLKSLQaEETLSP-QDIVH 151
gi 500135772  87 LSSTYGQTSa------------GGLHLELLSDDVVENKLLASRMALTISEQVHQPFDTLRQCTRSLQ--DQELESRDIFR 152
gi 743533481  90 PSGGAESNAsg----------saPLTFELLSDDVVENRILASRMALAMGETLQPGFEAMRLRIQALEg--HELASRDMFR 157
gi 120593123  84 AAAGTVRKSlnprr---slssvSFDELELMGDNQVQEAVESARLQQLVRLACESGLAGFSARLSTAQgFLVVKGDSNPLR 160
gi 504829138  86 VSSTRGQLAagg--------ggGLSQFELLSDDVVENKILASRMALTVNEQVSHQFDTLRQRTQSLE--GQELDSSDILR 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  169 PEALAHAFAASLTGQPVDIRVTLLILKLFDRHVLCQMGTTYRQMNQLLADHGVLP-DASLV----------FK------- 230
gi 122479557 176 PEVFVRAFLLAWENSGLDKQATEDLMLSLDPLHSIDLTPLYADLNAMLTHAGIAA-QPARR----------VIksegags 244
gi 504591242 174 PGHLFSAMLQALTEMDVDRELSLALLQSFERQTANELPGLYADLNRHLAQSGILP-TIPLG----------APqs----- 237
gi 491364112 177 PRALFTTMLDALGALDVGEQLSLILLQEFERQTSAELPGIYADLNRFLAESDILP-NIPLA----------GPqr----- 240
gi 505248641 169 PMAICETLKSICWSQDAAGELRAAVLEMLVSRLTSDISTVYHDVNALLVSRKVMP-NVRAR----------AKrg----- 232
gi 551030371 152 PESLALPLIEQWGHCGLLREYWALVHDTIQKLLGLQLKEIYAHCNAELIDHGVLP-VIEFV----------ARpr----- 215
gi 500135772 153 PDTISLHLVEQWTNAGLPRVDLQTVVDPLQRKLADLLQKHYLAVNAFYDAQGVAPsDLKSR----------VRrtdtekg 222
gi 743533481 158 AETICLHLVEQWLGCGMERKHLLRAVEPLQNALAPLMESEYSILHKLLDAKGVSK-AQDAP----------LRvrrtegg 226
gi 120593123 161 PEVITLALIQLLQSLPVSSQTRACWLLDGAGIMGEELQALYVLLNDFLAGQGIEP-AAYGVvgapqgrtgrAWpt----- 234
gi 504829138 156 PDTVCLLLVEQWVEAGLPRTDLQTVVDPLQRELANLLQKHYQAVNVFYVEQGITP-QTDLK----------SKvrrtqgg 224
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  231 ----------------------------AKTSTM------------PEQ----------HRPSSAAHVREDdSAE----- 255
gi 122479557 245 -------------------------------------------------------sylplsPASAHAHLQG-GEMrsglg 268
gi 504591242 238 ---------------------------lSDAPSA------------GQPggsgmasggsAEPYRGASLGQG-SASygaas 277
gi 491364112 241 ---------------------------aLRSQPL------------DAG----------D---PHPALDEQ-PQTpaaaq 267
gi 505248641 233 ---------------------------kAV-------------------------------------------QRiaarr 242
gi 551030371 216 ---------------------------nDTLSAPigggttrqtgggTSG----------HAPSHVAQRSGG-QDRmarpa 257
gi 500135772 223 vlsrntqp-----gaqsqtmgwhsqyagAGTGGD------------MPR----------FGPSSATPAESR-LGRmvpap 274
gi 743533481 227 pstgam---------hlgassgygnasdAGWTNS------------AMQ----------YMPAGMAAGLGV-GTGmapgi 274
gi 120593123 235 ---------------------------gRLEGFQ------------ASP----------DFPEPANTGYGK-PEVvends 264
gi 504829138 225 tatgsgggdsgsgglasqalaqtrqammAARGGM------------QPP----------GMPAAGRPMGPP-GAQmpppg 281
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  256 -------------------------------QLSDLLHLLDLWKRQAG----------Ndas-----------------q 277
gi 122479557 269 dleperar-----------sawdalapagrsIASHARQFLQRLGLASS----------Sgqndsgagegadwtpadghet 327
gi 504591242 278 a-------------------------nvqqdIFSQLLQAIQTANPLHA----------Pantgw------------psap 310
gi 491364112 268 rq----------------------gehgnsdVFEQLAQALQAAASQRPvntgqlpsgmAptpra------------aqsq 313
gi 505248641 243 ng----------------------apgqeddAADIVKQLFSaraaa-------------------------------elp 269
gi 551030371 258 dhyaggm------------sprshrlgnargILDRVSRLIGDLVPQRG----------Avdtrgavdt-----ahhgaph 310
gi 500135772 275 ag------------------------mpaafgpGGISPMEQQRQQAQG----------Mvgqlhq-----------llts 309
gi 743533481 275 alppgasag---------lgmlararhraldAMNQLRQVLSQPAVGIP----------Glmpgtpvvp----mppasaal 331
gi 120593123 265 aq----------------------asrkpllTLDHLHHLLVGDYENSS----------Heptsfsaf-------gteelv 305
gi 504829138 282 yggyprpqhgmptafatgmtplararqraqgVMGQLRRLLTQPATGFD----------M--------------------- 330
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  278 tDG------QHFDPGEVVGALSLL-Q----QSASA--------LAs-gEWRPGAPIPRLKQSLVEQLTGFCPDGELRRLG 337
gi 122479557 328 rTY------LASADPEFMGYLGDL-Q----AGAQ--------------AESAERILPGQHPGDRNVLRQMRDRDEVRRAP 382
gi 504591242 311 sAGlgpspsANVSVHQLVDALSGL-Q----RGQAD--------PQ---SMP-GLGAVRIDPDRGNVLRQIRSTPMANWSH 373
gi 491364112 314 pRQ------QTLGIAELIQALTGL-Q----RG-AG--------DV---RQLPGLGPAPIDPAQNDALQRIRATPMADWSH 370
gi 505248641 270 dWK------RRTGAADLMQLLSGL-Q----RGQSD--------VG---LGGQEFSIEPEAAASGNVITRLVEAGLGKHVG 327
gi 551030371 311 tVP------YTAPSESLLQALQQQ-PtfdsQLQAQ--------VP---EGYEVQYAPVVIERVASGLRQQTSSIKAHAKS 372
gi 500135772 310 aAG------PAPASMALAQALAAY-R----MQAIAsvdagagaGA---IDGLASDAPVAVVQLVSAAREQSIELKQKAET 375
gi 743533481 332 aQA------LQEQQQLMAAELQAQyP----SAAGS--------AM---AMPAMDYSPAAIGQLVNLVRERSADWKQKAET 390
gi 120593123 306 hQD------FSHTVPAALDVLTEL-Ee--kGLVSA--------RT---KLTRPAPSPP--------VAQLRARLKTDAKT 357
gi 504829138 331 -VN------APPASAALAHALTAH-R----VNADT--------YYsgvATLMEDYSPAAVVQLVGAVRERSTELKKKATT 390
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  338 RFEEDVIDMVSMIFDFILEDRNLPDPVKALIARLQIPVVKVAIIERSFLAKKTHPLRALLNALAQAGVGLePDDRKD-RI 416
gi 122479557 383 ELDRGTVDALAEVFDFVFADQAIPVQMKFVIGRLQIPVLKAAMIDRDFFLSADHPARRLVDTLAQASIAWaPEKGES-DP 461
gi 504591242 374 PMDAMTIDIVSMLFDAIFNDPDLSATMRAEIAKLQIPVLKVALLDKSFFSDRKHPARHLLDVIANSGIGRgEHDE---PR 450
gi 491364112 371 PVDALTIDIVSMLFDAMFKDPELSAGIRAELAKLQIPVLKVALIDKHFFSERRHPARRLLDLIASSGLGRgEEDE---PR 447
gi 505248641 328 TLDGIIIDVVATLFDYIFDDSRIPDAMKGLIGRLQIPVLKLAMMDHGFFANRGHPARRLINALAQAGVTWdGPLEAD-ST 406
gi 551030371 373 DSEKAIIELIALMFQSILQEDRIPTGVRVWFARLQIPVLRVALAEPDFFQKLDHPARQLIDRMGSCVLGFdASGISS-AA 451
gi 500135772 376 PAEKATIEVVALMFQSILSEERIPVAVRIWFARLQVPVLRVALAEPDFFSNLDHPARKLIDRMGACAMGFn-STAIDgSA 454
gi 743533481 391 KSEKATIEVVALMFQSILSEDRLPPSIRVWFARLQVPVLRVALAEPQFFSDLNHPARKLIDRMGSCVMGFdASSING-NA 469
gi 120593123 358 LGQSLAIEVVGLMIEQMANDERLLAPVRQVIASIEPAFLRLAVTDPRFFSDKTHPARKLLETITSASLGYaSENAPGfSE 437
gi 504829138 391 SGEKAIIEVVALMFQSILAEDRIPPAVRVWFARLQVPVLRVALAEPEFFSNLDHPARKLIDRMGACVLGF-DATTINgSA 469
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  417 VLKKIEEVVYRILTEFDEDTRIFAELLEDFSAFIEGERKGVKaMEERTRQAAISQERLALAKRAAAVEITARIekRPLP- 495
gi 122479557 462 LYVRIENTVQRVLTEFEDDLALFSELLAEFTEFLFETEQQAQgRIEPAVDHERVGESFEQALAHADEVIHARI--AALPs 539
gi 504591242 451 LTQKIHAIVESVVSGFDSDIQIFATQVQKLEEFLQDEDGRAQgKATQQVAKLEHDERSEIAASRVNEAIAPRVqrSQIP- 529
gi 491364112 448 LIERIRAIVDGVVDGFDDDVEVFARQLQAFEQFLNEEETRARgKASKVLGELARRDRREVAERRVEAVITEHa-hPEAP- 525
gi 505248641 407 LYRTAEAIVVRIQNEFSEDAEVFASCLQQFETYLVDQERNADaRAATLTDRLKERERQELARQVARDSVAGLLanEAIP- 485
gi 551030371 452 LETEIKRIVQVIEQYPETGQRVYVRVYEEFQSFLQQHLAQRNeSTIKVVGVAQQVEQKETLAIQYTIELRNQIqdMPVR- 530
gi 500135772 455 LEAQVRRAVQMIEQYPETGSRVFQLVLDEFEKFLAKFLTE-KqTTARLVTVAQQVEQKEALTIRYTIELRAMLrdMPVR- 532
gi 743533481 470 LETEIRRVVQVIEQYPETGQKVFALVLREFEEFLTRHFAQNR-STAKITSVAQQVEQKETLAIQYTIELRNMLtdMPVR- 547
gi 120593123 438 FMQNLQKVAVLLAQSQVSDAQHFAELLQDFERRQNRNTPEHRqAQRLAVQALLQAEQRNLMAAEIANEIRARPdfVESS- 516
gi 504829138 470 LEAEIRRVVQVIEQYPETGRRVFQLVYDEFEKFLAKFLTEKQ-VTSRLVSVAQQVEQRETLAIQYTIELRTML--RDMPv 546
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  496 -----PALVSLLLNAWKDVLVIAHLRREKDS------TDWDEALAIMD----RLIDWADAHDAEPRRADAGTGEPEAIRA 560
gi 122479557 540 elplaPFLAPFLTTQWREVLARAWLNVQASA------APWDSAVTSMD----QLIWSTQPKTRIEERRQLVALLPELVRR 609
gi 504591242 530 -----RLIVAFLERHWRQVLTAIFIRAGDTG------AEWAEAIRLMD----ELIWSVESKSGAQERDRLLALLPDLLKR 594
gi 491364112 526 -----ALISDFVSEHWRQVLVDVFIDTGEDG------EDWREAVQLMD----DLLWSVEPKLTQEDRDRLLTLLPDLITR 590
gi 505248641 486 -----QVVRSFIEGTWIKVLAAASLETAGGSepakegERWREAMATVD----ELVWSVLPMQGAESRQLLVKRLPGILQN 556
gi 551030371 531 -----DEIREFLYKVWAEVLAVSTIRQGAQH------PDTLLLKKTAA----DLIWAASAKPNRADRARVIADLPDLLKS 595
gi 500135772 533 -----DELRDFLFKVWAEVLALSALRDGPQH------MDTITLKRTAA----DLVWSASAKPHRKDRTLVIQSLPSLLQR 597
gi 743533481 548 -----EEVRDFLFKSWADVLAMATVRYGAKD------ARAMRLKQAAS----ELVWSASAKPLRQERARVIQGLPTLLQT 612
gi 120593123 517 -----RTITAFLTGPWAQVMARERL--AGQS------ETFGTSQAVFSltlgDVLWSLDIAPVASHQKRLLKMIPDMLQS 583
gi 504829138 547 ----rDEIREFLFKTWAEVLALSAVRDGPQH------ADTVAFKRTAA----DLVWAASAKPNRSDRAQVIQNLPALLQR 612
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  561 ARERLENIAFDPGQLHAFFKDLELWHLSRGNLGPT---------------------PAPANATVEPCEIEDILI-----E 614
gi 122479557 610 LNAGLDAIEWVGEPRATFTRRLIATHMMAIRMTQAasv---------------dsmSAALEANAGKEAMNELEQ-----R 669
gi 504591242 595 LRQGLERVQLDGAWDD-FFSELIRLHMAALRNDPApdagp----------------segqALSSQPLPWPGETG-----M 652
gi 491364112 591 LRKGLERID-QETSWDSFFGQLIRLHMAALHREDTnnastt----------rdtaeDTISASASASASASASAS-----A 654
gi 505248641 557 VKAGMRRVSMDEAAQKAFFAELVQCHAAAMKAAPAapaatt--------------------------gapaaAP-----R 605
gi 551030371 596 LRTGMGSLGLHKAAQEVHIKIISDTLADAFMSKTHtiaaeqvqal-aerlvhledyLSDDGTEELPLDAQSIEE-----L 669
gi 500135772 598 LRQGLALLGVTGPQQDAQIKVLTNTLADAFQCKTAlipqaqiesm-akrldnledfISDTTLGDMPLNTENIEM-----L 671
gi 743533481 613 LREGLELVSVTGDAQSAAIKVLTDTLAQAFMSKTAaipaerieamakrlaelekyiSEDGKLDDMPLSSESIEL-----M 687
gi 120593123 584 LRQGLASIDFPVEQSRPFFDQLMAVHRVALKARPEvpadapkk-----thvlekmfAEAEDQDVAPLWMAPSEAqhsgfM 658
gi 504829138 613 LRQGLSLLGVNGEAQDAQVKVLTDTLADAFLSKTAsipqahidam-akrlanledfISDATLGDMPLNADNIEM-----M 686
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81680691  615 GM-----EDAQPAAQSa---P----AID--------------ESFVEQARNLCAGDWVEFCDGpALPFRAKLLLKSRFTS 668
gi 122479557 670 RS-----GQL----------A----GSV--------------DDFDAMAQSFTRGLWFDFLLDeHTQHRCLLSWVSPMRT 716
gi 504591242 653 TDsvvqpPPASAQAPP----E----GTE--------------DRHLRLVQALEVGAWIEFQSFrGTRNTLRLNWVSEFKR 710
gi 491364112 655 SA-----SDD----VD----D----AEA--------------DHHLRLARALEVGAWVEFKSVrGTRKTLRLSWVSEYRG 703
gi 505248641 606 PA-----GRASTFRPP----D----EEP--------------TPELLELDLLSRGSWVELKDEsGDIRRMRLTWISPART 658
gi 551030371 670 FE-----VDASELEVItsggS----TAN--------------PEGIEWARSLQLGDWFTLDHNs-NVAQVQYMWRSPMGH 725
gi 500135772 672 LG-----IDASSIHVV----AdngtPVD--------------DAMLAWAQQLPLGNWYTLDHN-GVAVQAQYAWHSERKQ 727
gi 743533481 688 LG-----VDAGDLNVIantdS----PVE--------------PAMLEWAQSLESGRWFTLDHN-GARVQVQYVWHSRRKH 743
gi 120593123 659 ED-----WDGPSVAGE----P----RNDmlepqdsvsaaisgLAGLGESIGLNLGDWVDLLVD-MQWLRAQLTWISPRST 724
gi 504829138 687 LG-----IDASSIHVIadngA----PVD--------------DAMVAWAQDLQPGTWYTLDHN-GASAQVQYAWQSQRKQ 742
                        890       900       910       920       930
                 ....*....|....*....|....*....|....*....|....*....|.
gi 81680691  669 RYVFVNRRGmKLREIGLHELASGLAANTIRLIagANEPLLDRALNAVVDTL 719
gi 122479557 717 RLLFTNRDGfDAFVRSEREVAALLRHGRLHVI--DQQPIVSRALDRIMseg 765
gi 504591242 711 VYLFTNRQGeNAMTLAATSLAEHLRKGTARLL--SQNPLTDRAVAQVLEKi 759
gi 491364112 704 VYLFTNRQGdNALTLATTSLANHLRQGSARLL--SQDPLTERAVSQVLERr 752
gi 505248641 659 MYLFANRQGvRALALTRDELKRRFANGEARTA--DQEPLLDRVVDDVLDEL 707
gi 551030371 726 LHLFANQIG-RSYLIQSARLAAYLQAGLLVAQ--EEESLTVRATRDALGKi 773
gi 500135772 728 LHLFATVDG-RSYLIQLRRLATYLQAGLLLAQ--DNEGLTVRATRDALAKL 775
gi 743533481 744 LHLFASLDG-HCYLLQAQRMATYLQAGLLAVH--DAEALTVRATRDALQKi 791
gi 120593123 725 LFMFTSE-GgRKHSMTSHVLRHLLKLNLVKVI--SQQGVFEGALDSVARTa 772
gi 504829138 743 LHLFAAVDG-SSYLIQLRRLAAYLQAGLLVAQ--DEEGLTLRATRDALAKL 790
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap