Conserved Protein Domain Family
DUF1631

?
pfam07793: DUF1631 
Protein of unknown function (DUF1631)
The members of this family are sequences derived from a group of hypothetical proteins expressed by certain bacterial species. The region concerned is approximately 440 amino acid residues in length.
Statistics
?
PSSM-Id: 336811
View PSSM: pfam07793
Aligned: 62 rows
Threshold Bit Score: 434.416
Threshold Setting Gi: 947401385
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  127 STDSASLLMRQCERVIHQHLTPLFDTYLRALPKSFDEAINTAPTDNQRSQLADAAIALAKQNEIFSSQFFKHIGQALTPR 206
gi 122479557   16 LRRPARHLLRSLIGKTLAFFVEREDDNLTRVREHLMDLLDARPSPVRAQNLRSARQLLHKQADVFNRAFQAALQTSMDEE 95
gi 504591242   22 MPEDARSILATCRDRLAQGVIAVFVKHLGRANDEFLGLADRAINLEQQQICFAAMHFIANRAQPLLDRFQKIYVAAFDAS 101
gi 491364112   23 ASADPASLLAACRDRIAHGLATVFAQHLDSANDDFLGMADRATSLEQQQLYFAAMDFLSGHGQLLLQQFRSAYVAQFESA 102
gi 551030371    6 SDRRHQALADKVRLRLVAELSQSMDTLAQRVRERLLELLDQPASSKDAQLRRDAWTLYQRHQALWCDATRRAWQAALQPT 85
gi 500135772    7 PSSAQRRLLRQARQMFVDGICAGLSELDQTLLDFLVELTQQAGTARQAQSRRDALMRYREFHGLWTERCARAWQEALIPH 86
gi 505248641   15 PFRPHKGVLLECRDFVSQRVREALARAVGEVDAELQGRRGDATSGDESQRLIELQVLIRRVGADLDRAFSTGFDKQFQER 94
gi 743533481   10 APAAPQQLGWQARLRWVHGICQGLPKVARQLDEFLSNQSSAVSTAKEMQEWREAWVGFQQNKDAWLQAGAQALQQAARKP 89
gi 120593123    4 SSQAPTAAFQSCVDEVLRQSAFLIDRWSSKLVSAMYERSLAVHEPAERHQIQAAIAVLKKNRLMFEQGFSAKLKKAIADD 83
gi 504829138    6 PSVPQRRLARQARQRFVEGICGGLADLDKTVQDFLTALMNQTGTAREMQSRRDAWLQYQQKHAAWTERTGKAWQEALAPH 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  207 AvSAVKKEE--------------E--CTDLSLIDKSEFEDWLTLKVMVTKAETAYRAVLVQLKMRLDAAg-VVCHKGYNN 269
gi 122479557   96 M-RAVLPEApasavandtsadplD--GMTLSLIDVCEVERILLVDRVAQRFTAHYDASVSALTQRLGVLlgRDVAALSSN 172
gi 504591242  102 V-AGLGGERprs--------sprG--LDELQLIDTEEFEQDLAIGKVSTRAAFNCSQQLVALDRRLAVLlrLQRIGQDEN 170
gi 491364112  103 V-AALRGTTveg--------graSqePRELSLIETDDFERDLAIAKLSARAACNCAQQLTALDRRFAALlhLSRITQDDN 173
gi 551030371   86 P-STRSGPLal---------------daGLQLVGTDVVENRILASRLALGVMEHAASEVNDLRKRLKSLqaEETLSP-QD 148
gi 500135772   87 L-SSTYGQTs------------aG--GLHLELLSDDVVENKLLASRMALTISEQVHQPFDTLRQCTRSLq--DQELESRD 149
gi 505248641   95 A-GAASPAGdfyq------knngF--FPELSLVEESVIDESLMVRNLSARLERNCEAESHDLQTRVAFMlgENDIDNTNN 165
gi 743533481   90 P-SGGAESNasg------------saPLTFELLSDDVVENRILASRMALAMGETLQPGFEAMRLRIQALe--gHELASRD 154
gi 120593123   84 A-AAGTVRKslnprr---slssvS--FDELELMGDNQVQEAVESARLQQLVRLACESGLAGFSARLSTAqgFLVVKGDSN 157
gi 504829138   86 V-SSTRGQLaag--------gggG--LSQFELLSDDVVENKILASRMALTVNEQVSHQFDTLRQRTQSLe--GQELDSSD 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  270 AVGPPLLCYALRDTLMQLHLPLPAERLCLRVFERTVLAELGPVYAELNELLVRRGVLP--NLDLSKYlstpeaekkaeee 347
gi 122479557  173 PFRPEVFVRAFLLAWENSGLDKQATEDLMLSLDPLHSIDLTPLYADLNAMLTHAGIAA--QPARRVI------------- 237
gi 504591242  171 PLYPGHLFSAMLQALTEMDVDRELSLALLQSFERQTANELPGLYADLNRHLAQSGILP--TIPLGAP------------- 235
gi 491364112  174 PLHPRALFTTMLDALGALDVGEQLSLILLQEFERQTSAELPGIYADLNRFLAESDILP--NIPLAGP------------- 238
gi 551030371  149 IVHPESLALPLIEQWGHCGLLREYWALVHDTIQKLLGLQLKEIYAHCNAELIDHGVLPviEFVARPR------------- 215
gi 500135772  150 IFRPDTISLHLVEQWTNAGLPRVDLQTVVDPLQRKLADLLQKHYLAVNAFYDAQGVAPs-DLKSRVR------------- 215
gi 505248641  166 PIGPMAICETLKSICWSQDAAGELRAAVLEMLVSRLTSDISTVYHDVNALLVSRKVMP--NVRARAK------------- 230
gi 743533481  155 MFRAETICLHLVEQWLGCGMERKHLLRAVEPLQNALAPLMESEYSILHKLLDAKGVSK--AQDAPLR------------- 219
gi 120593123  158 PLRPEVITLALIQLLQSLPVSSQTRACWLLDGAGIMGEELQALYVLLNDFLAGQGIEP--AAYGVVG------------- 222
gi 504829138  153 ILRPDTVCLLLVEQWVEAGLPRTDLQTVVDPLQRELANLLQKHYQAVNVFYVEQGITP--QTDLKSKvrrtqggtatg-- 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  348 iakkppaegkqdpfsA-----------------EDKERAE-------------QLRQKlmgsnheeskqPAKPVTPPAPp 397
gi 122479557  238 ---------------K-----------------SEGAGSS-------------YLPLS-----------PASAHAHLQG- 260
gi 504591242  236 ---------------Q-----------------SLSDAPS-------------AGQPGgsgmasggsaePYRGASLGQG- 269
gi 491364112  239 ---------------Q-----------------RALRSQP-------------LDAGDphpaldeqpqtPAAAQRQGEH- 272
gi 551030371  216 ---------------N-----------------DTLSAPI-------------GGGTTrqtgggtsghaPSHVAQRSGG- 249
gi 500135772  216 ---------------RtdtekgvlsrntqpgaqSQTMGWH-------------SQYAGagtggdmprfgPSSATPAESR- 266
gi 505248641  231 ---------------R-----------------GKAVQRI-------------A----------------ARRNGAPGQ- 248
gi 743533481  220 ---------------V-----------------RRTEGGPstgamhlgassgyGNASDagwtnsamqymPAGMAAGLGV- 266
gi 120593123  223 ---------------A-----------------PQGRTGR-------------AWPTGrlegfqaspdfPEPANTGYGK- 256
gi 504829138  229 ----sgggdsgsgglA-----------------SQALAQT-------------RQAMMaarggmqppgmPAAGRPMGPP- 273
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  398 PSGAQGERdmhgylADAET------------------------------S-------------FAAVNKLFEILESNRAL 434
gi 122479557  261 GEMRSGLG------DLEPErarsawda---------------lapagrsI-------------ASHARQFLQRLGLASSS 306
gi 504591242  270 SA---SYG------AASANvq--------------------------qdI-------------FSQLLQAIQTANPLHAP 301
gi 491364112  273 GNSDVFEQ------LAQALqa--------------------------aaS-----------------QRPVNTGQLPSGM 303
gi 551030371  250 QDRMARPA------DHYAGgmsprsh----------------rlgnargI-------------LDRVSRLIGDLVPQRGA 294
gi 500135772  267 LGRMVPAP------AGMPAaf-----------------------------------------gpGGISPMEQQRQQAQGM 299
gi 505248641  249 EDDAA-----------------------------------------------------------DIVKQLFSaraaa--- 266
gi 743533481  267 GTGMAPGI------ALPPGas--------------------------agLgmlararhraldaMNQLRQVLSQPAVGIPG 314
gi 120593123  257 PEVVENDS------AQASRkp--------------------------llT-------------LDHLHHLLVGDYENSSH 291
gi 504829138  274 GAQMPP----------PGYggyprpqhgmptafatgmtplararqraqgV-------------MGQLRRLLTQPATGFDM 330
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  435 lkqkelqa-------ppfpkpsEA------PQFR------------NEEILFNL-------QSVQQHPP------G---E 473
gi 122479557  307 gqndsgagegadwtpadghetrTY------LASA------------DPEFMGYL-------GDLQAGAQ------A---E 352
gi 504591242  302 antgw------------psapsAGlgpspsANVS------------VHQLVDAL-------SGLQRGQA------D---P 341
gi 491364112  304 aptpra-----------aqsqpRQ------QTLG------------IAELIQAL-------TGLQRGAGd----vR---Q 340
gi 551030371  295 vdtrgavdt-----ahhgaphtVP------YTAP------------SESLLQALqqqptfdSQLQAQVP------E---G 342
gi 500135772  300 vgqlhq-----------lltsaAG------PAPA------------SMALAQAL-------AAYRMQAI------A---S 334
gi 505248641  267 ------------------elpdWK------RRTG------------AADLMQLL-------SGLQRGQS------DvglG 297
gi 743533481  315 lmpgt------------pvvpmPP------ASAAlaqalqeqqqlmAAELQAQY-------PSAAGSAM------A---M 360
gi 120593123  292 eptsfsaf-------gteelvhQD------FSHT------------VPAALDVL-------TELEEKGL------V---S 330
gi 504829138  331 ----------------------VN------APPA------------SAALAHAL-------TAHRVNADtyysgvA---T 360
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  474 -----------GVSLDESGLR--ERLFNVLQNNEAGLK--SFGAEQDKALDVVDRFFASLLKNQKLSGIAKMQIKGLELP 538
gi 122479557  353 -----------SAERILPGQH--PGDRNVLRQMRDRDEvrRAPELDRGTVDALAEVFDFVFADQAIPVQMKFVIGRLQIP 419
gi 504591242  342 -----------QSMPGLGAVRidPDRGNVLRQIRSTPManWSHPMDAMTIDIVSMLFDAIFNDPDLSATMRAEIAKLQIP 410
gi 491364112  341 -----------LPGLGPAPID--PAQNDALQRIRATPMadWSHPVDALTIDIVSMLFDAMFKDPELSAGIRAELAKLQIP 407
gi 551030371  343 -----------YEVQYAPVVI--ERVASGLRQQTSSIKahAKSDSEKAIIELIALMFQSILQEDRIPTGVRVWFARLQIP 409
gi 500135772  335 vdagagagaidGLASDAPVAV--VQLVSAAREQSIELKqkAETPAEKATIEVVALMFQSILSEERIPVAVRIWFARLQVP 412
gi 505248641  298 -----------GQEFSIEPEA--AASGNVITRLVEAGLgkHVGTLDGIIIDVVATLFDYIFDDSRIPDAMKGLIGRLQIP 364
gi 743533481  361 -----------PAMDYSPAAI--GQLVNLVRERSADWKqkAETKSEKATIEVVALMFQSILSEDRLPPSIRVWFARLQVP 427
gi 120593123  331 -----------ARTKLT---R--PAPSPPVAQLRARLKtdAKTLGQSLAIEVVGLMIEQMANDERLLAPVRQVIASIEPA 394
gi 504829138  361 -----------LMEDYSPAAV--VQLVGAVRERSTELKkkATTSGEKAIIEVVALMFQSILAEDRIPPAVRVWFARLQVP 427
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  539 VLRLLMRNPDFLEQHENTAHKVINRIAQIGVKG---GRNS-QSVLERINTLIHRIQADHERDPGVFDEALAELDELLERQ 614
gi 122479557  420 VLKAAMIDRDFFLSADHPARRLVDTLAQASIAWapeKGES-DPLYVRIENTVQRVLTEFEDDLALFSELLAEFTEFLFET 498
gi 504591242  411 VLKVALLDKSFFSDRKHPARHLLDVIANSGIGRgehDE---PRLTQKIHAIVESVVSGFDSDIQIFATQVQKLEEFLQDE 487
gi 491364112  408 VLKVALIDKHFFSERRHPARRLLDLIASSGLGRgeeDE---PRLIERIRAIVDGVVDGFDDDVEVFARQLQAFEQFLNEE 484
gi 551030371  410 VLRVALAEPDFFQKLDHPARQLIDRMGSCVLGFdasGISS-AALETEIKRIVQVIEQYPETGQRVYVRVYEEFQSFLQQH 488
gi 500135772  413 VLRVALAEPDFFSNLDHPARKLIDRMGACAMGFn-sTAIDgSALEAQVRRAVQMIEQYPETGSRVFQLVLDEFEKFLAKF 491
gi 505248641  365 VLKLAMMDHGFFANRGHPARRLINALAQAGVTWdgpLEAD-STLYRTAEAIVVRIQNEFSEDAEVFASCLQQFETYLVDQ 443
gi 743533481  428 VLRVALAEPQFFSDLNHPARKLIDRMGSCVMGFdasSING-NALETEIRRVVQVIEQYPETGQKVFALVLREFEEFLTRH 506
gi 120593123  395 FLRLAVTDPRFFSDKTHPARKLLETITSASLGYaseNAPGfSEFMQNLQKVAVLLAQSQVSDAQHFAELLQDFERRQNRN 474
gi 504829138  428 VLRVALAEPEFFSNLDHPARKLIDRMGACVLGFd-aTTINgSALEAEIRRVVQVIEQYPETGRRVFQLVYDEFEKFLAKF 506
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  615 NLLYRrNVERVTAAAEGQQKVEEAKQAVIDEIEQRIagKQVP------RAVATLLNGGWRDLLSLTYIRQGPSS------ 682
gi 122479557  499 EQQAQgRIEPAVDHERVGESFEQALAHADEVIHARI--AALPselplaPFLAPFLTTQWREVLARAWLNVQASA------ 570
gi 504591242  488 DGRAQgKATQQVAKLEHDERSEIAASRVNEAIAPRVqrSQIP------RLIVAFLERHWRQVLTAIFIRAGDTG------ 555
gi 491364112  485 ETRARgKASKVLGELARRDRREVAERRVEAVITEHa-hPEAP------ALISDFVSEHWRQVLVDVFIDTGEDG------ 551
gi 551030371  489 LAQRNeSTIKVVGVAQQVEQKETLAIQYTIELRNQIqdMPVR------DEIREFLYKVWAEVLAVSTIRQGAQH------ 556
gi 500135772  492 LTE-KqTTARLVTVAQQVEQKEALTIRYTIELRAMLrdMPVR------DELRDFLFKVWAEVLALSALRDGPQH------ 558
gi 505248641  444 ERNADaRAATLTDRLKERERQELARQVARDSVAGLLanEAIP------QVVRSFIEGTWIKVLAAASLETAGGSepakeg 517
gi 743533481  507 FAQNR-STAKITSVAQQVEQKETLAIQYTIELRNMLtdMPVR------EEVRDFLFKSWADVLAMATVRYGAKD------ 573
gi 120593123  475 TPEHRqAQRLAVQALLQAEQRNLMAAEIANEIRARPdfVESS------RTITAFLTGPWAQVMARERL--AGQS------ 540
gi 504829138  507 LTEKQ-VTSRLVSVAQQVEQRETLAIQYTIELRTML--RDMPv----rDEIREFLFKTWAEVLALSAVRDGPQH------ 573
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  683 QAWYDYLSVLD----TLI-----HVGNDPGFEF--NLPELLRIIQDGLSAISSNHMPSGHIRDELKRFLVRRVGAE---- 747
gi 122479557  571 APWDSAVTSMD----QLIwstqpKTRIEERRQLvaLLPELVRRLNAGLDAIEWVGEPRATFTRRLIATHMMAIRMTqaas 646
gi 504591242  556 AEWAEAIRLMD----ELIwsvesKSGAQERDRLlaLLPDLLKRLRQGLERVQLDGAWDD-FFSELIRLHMAALRNDpapd 630
gi 491364112  552 EDWREAVQLMD----DLLwsvepKLTQEDRDRLltLLPDLITRLRKGLERID-QETSWDSFFGQLIRLHMAALHREdtnn 626
gi 551030371  557 PDTLLLKKTAA----DLIwaasaKPNRADRARViaDLPDLLKSLRTGMGSLGLHKAAQEVHIKIISDTLADAFMSKthti 632
gi 500135772  559 MDTITLKRTAA----DLVwsasaKPHRKDRTLViqSLPSLLQRLRQGLALLGVTGPQQDAQIKVLTNTLADAFQCKtali 634
gi 505248641  518 ERWREAMATVD----ELVwsvlpMQGAESRQLLvkRLPGILQNVKAGMRRVSMDEAAQKAFFAELVQCHAAAMKAApaap 593
gi 743533481  574 ARAMRLKQAAS----ELVwsasaKPLRQERARViqGLPTLLQTLREGLELVSVTGDAQSAAIKVLTDTLAQAFMSKtaai 649
gi 120593123  541 ETFGTSQAVFSltlgDVLwsldiAPVASHQKRLlkMIPDMLQSLRQGLASIDFPVEQSRPFFDQLMAVHRVALKARpevp 620
gi 504829138  574 ADTVAFKRTAA----DLVwaasaKPNRSDRAQViqNLPALLQRLRQGLSLLGVNGEAQDAQVKVLTDTLADAFLSKtasi 649
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  748 -------------------PEMVTMPDNREETSDPGV-----QLL-----GEAr---------Q----RGL--------- 776
gi 122479557  647 ---------------vdsmSAALEANAGKEAMNELEQ-----RRS-----GQL----------A----GSV--------- 678
gi 504591242  631 ag----------------psegqALSSQPLPWPGETG-----MTDsvvqpPPAsaq----appE----GTE--------- 672
gi 491364112  627 ast----------trdtaeDTISASASASASASASAS-----ASA-----SDDv--------dD----AEA--------- 665
gi 551030371  633 aaeqvqa-laerlvhledyLSDDGTEELPLDAQSIEE-----LFE-----VDAselevitsggS----TAN--------- 688
gi 500135772  635 pqaqies-makrldnledfISDTTLGDMPLNTENIEM-----LLG-----IDAssi----hvvAdngtPVD--------- 690
gi 505248641  594 aat--------------------------tgapaaAP-----RPA-----GRAstf----rppD----EEP--------- 620
gi 743533481  650 paerieamakrlaelekyiSEDGKLDDMPLSSESIEL-----MLG-----VDAgdlnviantdS----PVE--------- 706
gi 120593123  621 adapk-----kthvlekmfAEAEDQDVAPLWMAPSEAqhsgfMED-----WDGpsv----ageP----RNDmlepqdsvs 682
gi 504829138  650 pqahida-makrlanledfISDATLGDMPLNADNIEM-----MLG-----IDAssihviadngA----PVD--------- 705
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534637  777 -----QRWLMRAQKLKVGDWLRLERDeKEAEFIRLVWVGRSFSRYVFVNHQGmKVIDLDALTLAAYLQKGIAAPDesVDT 851
gi 122479557  679 -----DDFDAMAQSFTRGLWFDFLLDeHTQHRCLLSWVSPMRTRLLFTNRDGfDAFVRSEREVAALLRHGRLHVI--DQQ 751
gi 504591242  673 -----DRHLRLVQALEVGAWIEFQSFrGTRNTLRLNWVSEFKRVYLFTNRQGeNAMTLAATSLAEHLRKGTARLL--SQN 745
gi 491364112  666 -----DHHLRLARALEVGAWVEFKSVrGTRKTLRLSWVSEYRGVYLFTNRQGdNALTLATTSLANHLRQGSARLL--SQD 738
gi 551030371  689 -----PEGIEWARSLQLGDWFTLDHNs-NVAQVQYMWRSPMGHLHLFANQIG-RSYLIQSARLAAYLQAGLLVAQ--EEE 759
gi 500135772  691 -----DAMLAWAQQLPLGNWYTLDHN-GVAVQAQYAWHSERKQLHLFATVDG-RSYLIQLRRLATYLQAGLLLAQ--DNE 761
gi 505248641  621 -----TPELLELDLLSRGSWVELKDEsGDIRRMRLTWISPARTMYLFANRQGvRALALTRDELKRRFANGEARTA--DQE 693
gi 743533481  707 -----PAMLEWAQSLESGRWFTLDHN-GARVQVQYVWHSRRKHLHLFASLDG-HCYLLQAQRMATYLQAGLLAVH--DAE 777
gi 120593123  683 aaisgLAGLGESIGLNLGDWVDLLVD-MQWLRAQLTWISPRSTLFMFTSE-GgRKHSMTSHVLRHLLKLNLVKVI--SQQ 758
gi 504829138  706 -----DAMVAWAQDLQPGTWYTLDHN-GASAQVQYAWQSQRKQLHLFAAVDG-SSYLIQLRRLAAYLQAGLLVAQ--DEE 776
                         970
                  ....*....|.
gi 123534637  852 PVVDQGLDAMV 862
gi 122479557  752 PIVSRALDRIM 762
gi 504591242  746 PLTDRAVAQVL 756
gi 491364112  739 PLTERAVSQVL 749
gi 551030371  760 SLTVRATRDAL 770
gi 500135772  762 GLTVRATRDAL 772
gi 505248641  694 PLLDRVVDDVL 704
gi 743533481  778 ALTVRATRDAL 788
gi 120593123  759 GVFEGALDSVA 769
gi 504829138  777 GLTLRATRDAL 787
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap