Conserved Protein Domain Family
DUF1639

?
pfam07797: DUF1639 
Protein of unknown function (DUF1639)
This approximately 50 residue region is found in a number of sequences derived from hypothetical plant proteins. This region features a highly basic 5 amino-acid stretch towards its centre.
Statistics
?
PSSM-Id: 311646
View PSSM: pfam07797
Aligned: 64 rows
Threshold Bit Score: 50.2654
Threshold Setting Gi: 685335252
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 75169246  125 LSRDEIEQDFSFVFGKKPPKRPKKRPRLVQKKLNTIFPGLWLneEEVTIDSY 176
gi 586687971 107 LSRKEKEDDFLAM-GGRLALRPKKRPKYIQKKIDRLLPGGWL--PDVNPNTY 155
gi 413948407 160 LSRKEKEEDFMAMKGTKLPQRPKRRPKIIEKTVSAICPGVWL--TDATRSRY 209
gi 923541798 106 LSSKEKEEDFMAMKGCKPSHRPKKRAKLIQKSLLLVSPGTWL--ADMCPDRY 155
gi 769794185 193 LSSKEKEEDFMAMKGCKLPPRPKKRAKFIQKSLLLVSPGAWL--CELSQERY 242
gi 297847898 130 LSNKEKEEDFLAMKGCKLPQRPKKRAKLVQKTLLLVSPGAWL--SDLCKERY 179
gi 212721302 151 LSNREKEEDFLVFRGSKLPQRPKKRAKVIQRTVNFVCPGTWL--CDLTLERY 200
gi 743934960  78 LTNKEKEEDFFLFKGSKLPQRPKKRAKFIQRTLNLVSPGAWL--CDLTLERY 127
gi 300681461 302 LSRKEKEDDFLVMKGTKLPQRPKKRAKNVDKSLQFVFPGMWL--SDLTKGRY 351
gi 218197246  86 LSRKEKEEDFMAMKGTKLPQRPKKRPKLVEKQVNFVCPGMWL--SDVTRSKY 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap