Conserved Protein Domain Family
DUF1644

?
pfam07800: DUF1644 
Protein of unknown function (DUF1644)
This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, and is probably a zinc-binding domain.
Statistics
?
PSSM-Id: 336814
View PSSM: pfam07800
Aligned: 62 rows
Threshold Bit Score: 256.74
Threshold Setting Gi: 242048300
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75273865    22 DEVSCPVCMDHPHNAVLLLCSSHDKGCRSYICDTSYRHSNCLDRFKKLHSESANDPTPEANLASREHNNESLYEHGtasr 101
gi 769822056   24 EEVTCPICLDFPHNGVLFQCSSYEKGCRPFVCDTNYTHSNCFNRFMNAYQVSSNPTQSENVSGTLNLISPGSEE------ 97
gi 1091624633  27 DDIVCPICLDVPHNAVLLHCGSYDQGCRAFMCDTDDYHSNCLDRYKCAHGLPTITTVSSTTTGTPTQSIRVIPLGSg--- 103
gi 514726704   22 dRISCPICMEQPHNAVLLICSSYKNGCRCYVCNTSHRHSNCLDRFRKMNGDSKVLASHSTYSVLSNSNIRTVQPRAhyni 101
gi 242048300   22 dRISCPICMEQPHNAVLLICSSYKNGCRCYICNTSHRHSNCLDRFRKVNGDSKVRASHSTYSVLSNSNIRTVQPRAhynm 101
gi 573950690   22 dRISCPICMEQPHNAVLLICSSYKNGCRCYVCNTSHRHSNCLDRFREMNGDSKVRASHSTTSVISNSNNRTVERSShysm 101
gi 685257628   25 DDLVCPICLDSPHNGVLLQCSSYQNGCRAFVCNTDHLHSNCLHRFITACSTDSPPSTSPAAPEDNDETLSKV-------- 96
gi 571459416   11 EDVICPICLEVPHNSVLLQCSSYDKGCRSFVCDTSQLHSNCLDRFKSTHSMPSSSTYDSTSQMSDANSMANSESVV---- 86
gi 255574097   28 EEVVCPICLDFPHNSVLLQCSSYEKGCRPFVCDTDHLHSNCLDRFKSASGMSSPSTSDATTTANTQHSV----------- 96
gi 573948213   29 EDVTCPICLDYPHNAVLLRCTSYEKGCRPFVCDTDQTRSNCLERFKGAYELP----ANMKVSTIAVAPLDSIHIVA---- 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75273865   102 ssfhresgnrgss------------------------------------wdseslrrrrrveeeveSEDITNLKCPLCRG 145
gi 769822056   98 -----------------------------------------------------------------------HPVCPLCRG 106
gi 1091624633 104 ------------------------------------------------------------------S----SPTCPLCRG 113
gi 514726704  102 isrrsrsprpgrhvdneashrsnanngqnadgisrsepeivnyqeyenpalsigegsvviggchdaMQSSAEVKCPLCRG 181
gi 242048300  102 isrrsrsprlgrhvdnegsyhtnvnsgpnpd-disrpesdftsyqgfenstlpvegnivlgechdaMQSSAEMKCPLCRG 180
gi 573950690  102 iprqrrtnnannqep--------------------------------anstlsvedsivmeechdaMQSSADLKCPLCRG 149
gi 685257628   97 ------------------------------------------------------------------LEESCKPVCPLCRG 110
gi 571459416   87 ------------------------------------------------------------------SDCQYKLSCPLCRG 100
gi 255574097   97 ------------------------------------------------------------------VDGNSRLACPLCRG 110
gi 573948213  101 ------------------------------------------------------------------PNVNNRPSCPLCRG 114
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 75273865   146 TVLGWKVVEEVRTYLDHKNRSCSRESCSFTGNYQDLRRHARRTHPTTRPSDTDPSRERAWRRLENQREYGDIVS 219
gi 769822056  107 QVSGWVVIDSARTELNARKRRCEEEKCLFLGNYTELSEHMKLEHPHARPLEIDPARRLDWENLQQSSEIIDVLn 180
gi 1091624633 114 NVTGLVVVDEVRAYLNMMKRCCEEKQCLYVGNYMELQRHAKQEHPHSRPSKVDPDRQQDWENFQRSSEMIDVLS 187
gi 514726704  182 SVSGWIPAGEVRQYLDRKLRTCSHDSCKFVGTYEQLREHARNAHFLTKPAHVDLSRKRTWDRIEREQEVGDVIS 255
gi 242048300  181 SVSGWIPAGDVRQYLDNKLRTCSHDSCKFTGTYEQLREHARTAHVLTKPAHVDLSRKRTWDRLEREQEVGDVIS 254
gi 573950690  150 SVSGWIPASEVRKYLNEKLRACSHESCKFVGTYEQLREHARTVHLLAKPAHVDLSRKRTWDLLEREQEVGDVIS 223
gi 685257628  111 EVTGWVVVEEARALLDEKHRSCEEERCRFIGTYTELRQHAKSEHPDSRPSKIDPARKLDWENFQQSSEIIDVLS 184
gi 571459416  101 DVFGWIIVDKARVHLDEKKRCCEEEQCAFIGSYSELQKHAQLEHPHACPSKIDPVRQLDWKNFQQSSEIIDVLS 174
gi 255574097  111 EVSGWVAIEKARVHLDEKKRCCEEEQCTFTGTYLELCKHAQLEHPHARPSKIDPARQLDWENFQQSSEIIDVLS 184
gi 573948213  115 DVIGWIVINEARLHLNQKKRCCEEDCCSFVGNFNELQKHTQQKHPDSRPSEIDPARQVDWENFQQSSDIVDVLS 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap