3LQ9


Conserved Protein Domain Family
RTP801_C

?
pfam07809: RTP801_C 
Click on image for an interactive view with Cn3D
RTP801 C-terminal region
The members of this family are sequences similar to the C-terminal region of RTP801, the protein product of a hypoxia-inducible factor 1 (HIF-1)- responsive gene. Two members of this family expressed by Drosophila melanogaster, Scylla and Charybde, are designated by the GenBank as Hox targets. RTP801 is thought to be involved in various cellular processes. Its overexpression caused the apoptosis- resistant phenotype in cycling cells, and apoptosis sensitivity in growth arrested cells. Moreover, the protein product of the mouse homolog of RTP801 (dig2) is thought to be induced by diverse apoptotic signals, and also by dexamethasone treatment.
Statistics
?
PSSM-Id: 336818
View PSSM: pfam07809
Aligned: 40 rows
Threshold Bit Score: 116.513
Threshold Setting Gi: 675854108
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3LQ9_A         17 LAQARLGSRRPARLLXPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQG-KSC-HSVGQLAL-DPSLVPTFQLTLVLR 93
gi 74804565    13 LRIAKRQHLACTEVLLPADLLPRISAEMFEQSEKEPCGIRGCTIYIEFEDEpDNT-RRIATMKT-DPNTVSTFELYLTLK 90
gi 642931497   75 LRAAKRTHLSCGEVLLPSGLLHRIARDVLGMAESEPCGIRGCLIYVNFEGV-EQC-RKLASFKC-DPETATTFELKLTFK 151
gi 240848621   45 LRAAKRAQLSCGEVLLPPDLLHRIAHDVLKMAESEPCGLRGCTLYLNFEGE-QEC-RKIGTIKC-DTNTVSTFELFLTLK 121
gi 91088275    39 LKKAKRAHFACGEVLLPADLTRALAKDVLAKAETEPCGLKGCTIFINFESG-EER-RRLSVVNC-DPSTPTTFELYLTLR 115
gi 122117521  126 LRTAKRRHLACTEVLLPADLLPRIASQMFELSEKEPCGIRGCTVYIEFEDEpDNS-RRIATMKT-DPTTVSTFELYLTLR 203
gi 1005945080   7 eevlKQTKVIQSESDLPANLTKKIAQDIIGMSETEPCGLQGCLLYISLEDE-NHKpQTIGYVKLgEKTIVPTFVIYLHLR 85
gi 125979765  172 LRDAKQRHLACTEVNLPADLTERIAAEIIRMSDREPCGERACTLFIEFESEpNNV-RRIASFKV-DPDTVSIFELYLTLK 249
gi 194748158  133 LRAAKSRHLTCTEVSLPCDLTPNVARDIVRVSEKEPCGIRGCTIYIEFEDEpQNS-RRIATIKV-DPDTVSTFEVYLTLR 210
gi 91088273    48 IRKAKRTHLSCGEVLLPCGLLQKVAEDVLEIAETELYGLKGCTLYLLYEGE-EDC-RRLSNFKI-DPTTPSTFEIYLTFK 124
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
3LQ9_A         94 LDSRLWPKIQGLFS--------SANSP---SQSL---TLSTGFRVIKKKLYS 131
gi 74804565    91 QDRRGWTSILPQFL---------KNLAr--GSTI---MISPEFRLTKNKLYH 128
gi 642931497  152 QNPTGWNFIPQFLK----------NLAt--GGTI---VVSPAYVLTKKKLYR 188
gi 240848621  122 QNPRNAWSLIPLFI--------R-NFTs--GGTI---VIDHEFTIEKRKLYR 159
gi 91088275   116 QNVNGWNHFLPQFL---------KKMTr--SGTV---MISSEYDLQKKKLYR 153
gi 122117521  204 QDRSGWTSILATVSqvaiavegNFQTNypeGKTIschMGAVNGQHIDPALFS 255
gi 1005945080  86 RRYSDWFKFIATRF--------LRHLFr--DSSF---TIHDVYNLYKRKLFR 124
gi 125979765  250 QDKSGWTSLLPQFI---------KNLTr--SNTI---NISPDFTLTKNKLYS 287
gi 194748158  211 QDHRGWTSLLPQFMks-------------lARTI---TISPEYTITKNKLYS 246
gi 91088273   125 QANAGWTFLPQFLK----------KITr--GSTV---VISTEYELTKKKLYR 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap