Conserved Protein Domain Family
TMC

?
pfam07810: TMC 
TMC domain
These sequences are similar to a region conserved amongst various protein products of the transmembrane channel-like (TMC) gene family, such as Transmembrane channel-like protein 3 and EVIN2 - this region is termed the TMC domain. Mutations in these genes are implicated in a number of human conditions, such as deafness and epidermodysplasia verruciformis. TMC proteins are thought to have important cellular roles, and may be modifiers of ion channels or transporters.
Statistics
?
PSSM-Id: 311658
View PSSM: pfam07810
Aligned: 90 rows
Threshold Bit Score: 102.595
Threshold Setting Gi: 260793044
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094052   432 CWETSVGQEIYRLIVIDFVVSVIFLACLQASRYAMNRY----------YNRSI-S-LPEFCITNNSLGLVYNQTLLWFGL 499
gi 723127767   104 CWETMVGQEFVRLTVSDTMTTYITILIGDFLRAVFVRFfnyc--wcwdLEYGF-PsYSEFDISGNVLGLIFNQGMIWMGS 180
gi 1008433130  742 CWETNFGQELIKLTVMDLVMTILSTLAMDFIRGIFVRFmnrc--wcwdLEKVF-PqYGDFKVAENILHLVNNQGMVWMGM 818
gi 765130749   644 CWETAVGIEFVKLTVSDVQVTFLTILVGDFARALIVRFlnyc--wcwdLEAGF-PsYAEFDISGNVLGLVFNQGMIWMGV 720
gi 195326385   923 CWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYvnqn--wcwdMEKTF-PqYGDFKIAENILTLINNQGQVWMGI 999
gi 1005940614  885 CWETMFGQELAKILVADTLLGIVITIVADYGRALFVRYcndcscifwdLETQFpG-YSDFQIAENILSLVNNQANIWLGM 963
gi 313234002    18 CWESSVGQELAKLILFDIV------LVFDFLRGLIVRYlnpiw-pfwdLEGTY-PeYAEFKLADNILHLIYNQGILWLSC 89
gi 431894229   520 CWETAVGIEFMRLTVSDMLVTYITILLGDFLRACFVRFmnyc--wcwdLEAGF---------ANQVCGFCPSR----MGS 584
gi 1039759544  548 CWETAVGIEFMRLTVSDMLVTYLTILVGDFLRACFVRFmnhc--wcwdLEAGF-PsYAEFDISGNVLGLIFNQGMIWMGS 624
gi 701393823   597 CWETMVGQEFVRLTVSDTMTTYITILIGDFLRAVFVRFfnyc--wcwdLEYGF-PsYSEFDISGNVLGLIFNQGMIWMGS 673
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 122094052   500 LFSPMLCVVVAAKLFLTFYIKKLSLIYFCKPQSKLWRSS 538
gi 723127767   181 FYAPCLPAINVFRLHTSMYLQCWAVMCCNVPQERVFKAS 219
gi 1008433130  819 FFSPGLVVLNIFKLFVLMYFRTWIVLTCNVPHEIIFRAS 857
gi 765130749   721 FYAPGLMGVNVLRLLTSMYFQCWAVMSSNVPHERVFKAS 759
gi 195326385  1000 FFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKAS 1038
gi 1005940614  964 FFSPGLPGINTIRLCILMYLQSWAVLTSNIPHETVFKAS 1002
gi 313234002    90 YFAPGFPVIHLFKLILIFYLRCWSVLTTNLPSKRIFRAS 128
gi 431894229   585 FYAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKAS 623
gi 1039759544  625 FYAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKAS 663
gi 701393823   674 FYAPCLPAINVFRLHTSMYLQCWAVMCCNVPQERVFKAS 712
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap