Conserved Protein Domain Family
RanGAP1_C

?
pfam07834: RanGAP1_C 
RanGAP1 C-terminal domain
Ran-GTPase activating protein 1 (RanGAP1) is a GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state. Its C-terminal domain is required for RanGAP1 localization at the vertebrate nuclear pore complex, and is sumoylated by the small ubiquitin-related modifier protein (SUMO-1). This domain is composed almost entirely of helical substructures that are organised into an alpha-alpha superhelix fold, with the exception of the peptide containing the lysine residue required for SUMO-1 conjugation.
Statistics
?
PSSM-Id: 311674
View PSSM: pfam07834
Aligned: 13 rows
Threshold Bit Score: 230.69
Threshold Setting Gi: 597792251
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123908261 387 EEEEEEEKTELNQ------------FSTPPSAPr---TPDVSSFLSFPSPDKLLRLGEKRSVLIQQQV--DVLDVCKTAE 449
gi 524983512 394 QESLTPKKIIDSQ------------ASTPVPSP----PVDVATFLAFPSPEKLLRLGPKCSVLIAQQT--DTSDVEKVVA 455
gi 390333375 389 ESKDPHLQVKGTA------------ISPRREETkymiPVTAADFLAFPTANKLQALGNQRAEKILQELgdEVYEESAGIK 456
gi 405976660 338 EVNDPELQVKGKS------------ISPNKK-------VTAKDFLAFPSPSKLLQLGSGRAQALKEELgaDVNDLEKAVQ 398
gi 597792251 390 HNCVNGTKENGKD------------KGSPAKTNl--cSPDLISFFHSPTSEKLFNLGAKRTQLIEQQL--DFSDAARIAD 453
gi 551514731 397 EQENISSSSNNNKfptffslpphpkPSTPMSAPr---PPDVSSFLSFPSPDKLLKLGTKRTLLVQQQV--DVTDARKTAE 471
gi 432870737 394 EEEEEEEEEEKSQvn---------kMSTPVSAPr---PPDVSSFLTFPSPDKLLKLGAKRALLVQQEV--DTTDGRKTAE 459
gi 348511273 396 EEEEEEEESTGNK------------FSTPQSAPr---PPEVSSFLSFPSPDKLLKLGPTRALLIEQQV--DVSDAAKTAE 458
gi 597735171 391 EETEEEGDDEPNK------------MSTPPSAPr---PPDVSSFLCFPSPDKLLRLGKERAELIQQQV--DVSDVTKSVE 453
gi 612049132 393 EVTTPSKKILDTH------------VGEPPSvl--csPSDVSTFLAFPSPEKLLRLGPKSSLLIAQQT--DTSDPEKVVS 456
gi 675431375 393 QESLTPKKIIDSQ------------ASTPVPSP----PVDVATFLAFPSPEKLLRLGPKCSVLIAQQT--DTSDVEKVVA 454
gi 183986703 404 ENRTKPNKI-SSH------------VSTPAAPPk--lPVDASTFLSFPSPEKLVRMGPKRSTMIMQQI--DVADTEKVVQ 466
gi 924859486 396 ENGLNGTKDVIEE------------KEEPPH------SSELMSFLVSPSAEKLISLGAKRVQLIEQQV--DVTDANKVSE 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123908261 450 AFLKISSVYKDNdAEVKSAVLESIDAVLSKAFF-TPSFQGLAFVSSLLVMVGLLKSEDK-LKPVKVVPGHLLCLEHAVKQ 527
gi 524983512 456 TLLRISSVFKDE-APVKTAVHETTDALMKKAFG-SATFNSDAFITNLLVHMGLLKSEEK-IKTVPSLYGILMTLNHMVQQ 532
gi 390333375 457 AFVKISSVMESEnNDVKNAVYQCTDAILKKLFS-SEKCTPESVVNALLVHLGLIKGEDK-LRPVGDPSGMLLTLGHAVKQ 534
gi 405976660 399 AFMKISSVVTMEdTKAKEAACDCADQIIEEAVKcNRENDAVLLANTILVYIGVLKGEDKsYKPPNSVTGPLLVLEHIVRQ 478
gi 597792251 454 FFLQICS-VYEEeVEVKQVVLETADTLLRKGFS-SPHFQTYLFISSLMVNMGLLKGEKK-MKKMGVLPGHLIVLNHCVGQ 530
gi 551514731 472 AFLKIASVYKEEnNDVKNAVLDTIDALLSKAFS-TPSFQGYSFVSILLVLLGLIKSEDK-IKPVVVVPGHLHALEHVVRQ 549
gi 432870737 460 AFLKIASVYKEEnNDVKRAVLDTIDALLSKAFN-DTSFQGYNFVSALLVLLGLIKSEDK-VKPVLVVPGHLHAIEHAVRQ 537
gi 348511273 459 AFLKIASVYKEDnNEVKNAVLDSIDGLLRKAFT-SSSFQGYSFVSSLLVLLGLIKSEDK-VKPVIVVPGHLQALEHVVRQ 536
gi 597735171 454 AFLKISSVYKEEdPEVKAAVLDSIDAVLKKTFS-LPSAQTFSFISTLLVMLGLLKSEDK-VKPVAVVAGHLLCLEHAVKQ 531
gi 612049132 457 AFLKVTSVFKDD-LAVKTAVQDAVDALMKKAFA-SATFNSNAFITRLLIHMGLLKSEDK-IKAVPNLYGPLMALNHMAQQ 533
gi 675431375 455 TLLRISSVFKDE-APVKTAVHETTDALMKKAFG-SATFNSDAFITNLLIHMGLLKSEEK-IKAVPSLYGILMTLNHMVQQ 531
gi 183986703 467 TFIQVSSVYRDD-SEVKAAVEETIDGLMKKAFE-SRGFQENLFITSLLVHMGLLKSEDK-IKTVQHLNGPLLTLNHMVQQ 543
gi 924859486 456 VFLKISSVYKDE-PEVKQAVFETTDALLRKAFSnSPHSQSYSFISSLMVNLGLLKSEDKkVKKVSVLPGHLLTLEHAVSQ 534
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 123908261 528 SYFPREHITVLNAFMSRPNKSLEVCSSARDRLKNTLQ 564
gi 524983512 533 DYFPKSLAPVLSAFVTKPNRALDSCSFARHMLLQTLH 569
gi 390333375 535 QYYPKSTAPIFMTFLSRPNSKIDDCVSAKHGLMQAIY 571
gi 405976660 479 PYFPKFSREMLQAFCSKPHPLLDSTPQARHKLLQTLY 515
gi 597792251 531 DYFPVDQADVLLIFLSRNGKVLESCSKARDYLKTTLE 567
gi 551514731 550 DYFPKENVAVLEAFMSRSNKSLESCGNARNGLQSTLQ 586
gi 432870737 538 DYFPKESVAVLKAFMSRSSKSLESCGSAKNVLQSTLQ 574
gi 348511273 537 DYFPKESVAVLEAFMSRNNKTLEPCGNAKNNLQSTLQ 573
gi 597735171 532 SYFPREHIAVLHAFMTRPSKSMECCVGARDSLRSTLQ 568
gi 612049132 534 EYFPKSLTPVLLAFVTKPNRALEACSFARHNLLQTLH 570
gi 675431375 532 DYFPKSLAPVLSAFVTKPNRALDSCSFARHMLLQTLH 568
gi 183986703 544 NYFPKSLVPILLAFISKPNRVLENNASARHTLLHNLH 580
gi 924859486 535 EFFPADQAGVLESFVSRNGAVLESCCSARDALKITLV 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap