Conserved Protein Domain Family
DUF1634

?
pfam07843: DUF1634 
Protein of unknown function (DUF1634)
This family contains many hypothetical bacterial and archaeal proteins. A few members of this family are annotated as being putative transmembrane proteins, and the region in question in fact contains many hydrophobic residues.
Statistics
?
PSSM-Id: 311682
View PSSM: pfam07843
Aligned: 93 rows
Threshold Bit Score: 29.7044
Threshold Setting Gi: 123752984
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122252752  12 GDLLRAGVSAAGVIVFGGALLFLIAHG---------------GEpadyttfrGEPAELRNLGGMLR-SALSLEGRGVMQL 75
gi 123752984  22 SRVLLAGVLTSVVLMLLGMGLLALNPG-------------------------LAQANVLPVSQVLK-LIPHFHPMALIDL 75
gi 81617144   22 SQILRGGVLFAGIFLLAGWLWMWWRDGdnlqsftvyeprpliEN-------------------IQWaLVMNDRALLIAQF 82
gi 122361336  33 ALVLRIGGALGAALVLAGLTLAVAQGGaswlhgp-----------ggdplgaDAAMRLTDLSG----GLRHGRAGAVILL 97
gi 269785363  32 asgLRIVTLIGMVFLIVGTVVSLVQVG---------------DL----------PRATVPPSELPE-RLLALDAPAIVSL 85
gi 521285164  10 SSVLAVGMIASIIVLFIGLVMLIILGG---------------DY----------EEVTMSLSEIAQ-GILQGNPIAVIDL 63
gi 502773075   9 SNIYKIGVRLSILLIILGLISYSFSNH---------------GNf-------DYYNNFLSIKEVLV-LIFNLNFYAFLYL 65
gi 505283342  21 qfLLSGGVILSVTLMLVGLIALLWMGE---------------TSl-------TA----VSILDIFY-SDLGW-AYRLLSF 72
gi 506279291  21 GRVLGAGVVIAVVLVVAGLVVTLVSHPhfvvgpi-----------syhvlvgRRAHFPVGLGGLVR-ALRHGRGEGIVLL 88
gi 503651356   9 SKILTYGTVLSLLLIVLALIEMLLLHTs------------------------IETYSSVDILPILN-GLFSMNPTDTLYS 63
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 122252752  76 GIAILIATPIARVAFSVAAFAGARNGRYAAITAAVLAVLGYSMF 119
gi 123752984  76 GLLVLLLTPLARVIITGLGFALEGDWLFAAIALLVLVVLVISLA 119
gi 81617144   83 GLVVLVCLPLVRVLMTAILFLKQKDKGLAIMALAVFVALVGSFL 126
gi 122361336  98 GTIVLAATPAAGVIAAGLAWLRARRGWLVGAAVVVLLLLVLAGa 141
gi 269785363  86 GFLTILLAPVYGLISLAYGCLRQRDRFYAAAAGLVLTILVLSVV 129
gi 521285164  64 GIILLIITPLVRVISLAVTFAMKKEGKFVAACLIVLILVAVTVI 107
gi 502773075  66 GIYLIIITPLIAVVFLLVDSLKKGNYKLALLCFLIFFVLGLyly 109
gi 505283342  73 GMLILALTPAFRVITLLFLWWREKDWKFVGVSLAVlitltlsli 116
gi 506279291  89 GAVILLATPLAGVVASVIGFATAGVGRMAAVATVVLAILVVAAV 132
gi 503651356  64 SLLVIIFTPVASLIYLTFFFLITKDIPMIIFSFTVLCIIVSAVI 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap