Conserved Protein Domain Family
DUF1641

?
pfam07849: DUF1641 
Protein of unknown function (DUF1641)
Archaeal and bacterial hypothetical proteins are found in this family, with the region in question being approximately 40 residues long.
Statistics
?
PSSM-Id: 311685
View PSSM: pfam07849
Aligned: 82 rows
Threshold Bit Score: 32.7623
Threshold Setting Gi: 74544520
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 74543577    94 IKTEDVRPVgGLTGVLDKIRDEDTQKGIGIVFSLLRSLGR 133
gi 81592543   117 ESAKNDEIM-GMLAMMKALKDPDINRALRYGVTFLKEVGQ 155
gi 81584081   117 EHLESNKKV-GVFDLMKVLKDPDINRAIGFGLHFLKGMGK 155
gi 3915537    117 SFLKEDKKV-GILDLLKAMNDPDINRAVGFGLQFLKGMGK 155
gi 1020061998 117 EHLKQNKKT-RLRDLMKAMNDPDVNRAMGFGIHFLKGMGK 155
gi 339287600   84 ASRESDGSM-TVFSLLKALRNPDIARAIRVSLAFLEGFGh 122
gi 497480486  117 QGLKEDSKI-GIFDLMKALKDPDINRVLGFGFNLLKGMGE 155
gi 502515177  118 ATAADGKPL-GVFELLALLKDPNVSYAIRFLLGFLSGMGK 156
gi 1011860261 118 QTKEKDKKI-GIFDLLKAVNDPDINRAIRFILSSLKEFGK 156
gi 226089015  179 EARAAEKPI-GIFGLLRALRDPDVNRAISFALHASKAYGQ 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap