Conserved Protein Domain Family
Orai-1

?
pfam07856: Orai-1 
Click on image for an interactive view with Cn3D
Mediator of CRAC channel activity
ORAI-1 is a protein homolog of Drosophila Orai and human Orai1, Orai2 and Orai3. ORAI-1 GFP reporters are co- expressed with STIM-1 (ER CA(2+) sensors) in the gonad and intestine. The protein has four predicted transmembrane domains with a highly conserved region between TM2 ad TM3. This conserved domain is thought to function in channel regulation. ORAI1- related proteins are required for the production of the calcium channel, CRAC, along with STIM1-related proteins.
Statistics
?
PSSM-Id: 311691
View PSSM: pfam07856
Aligned: 36 rows
Threshold Bit Score: 111.961
Threshold Setting Gi: 301102610
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HKS_A         13 YLSWRKLQLSRAKLKASSWTSALLSGFAMVAMVEVQL-DhDTNVPPGMLIAFAICTTLLVAVHMLALMISTCILPNIETV 91
gi 168033216   88 EKNRRDVEEKSEQLKAVSSLAALFAGFAVVTLTQFGF-D-ADTVGIVWIALYGVLTALVVGLMTISMVTCTLILGSILKN 165
gi 168012498  132 EKNRRDVEEKSDQLKSISNLAALFCGFATVNLTQFNV-R-T-DYNWVLLGFYGVLTALVEGLMVISMVTCTLILGSIVKM 208
gi 159462636   80 DRNRTEVMEKTEQLKAVSSLSALLAGFALVGFLEFQFvV-SENYNKALLPLFALTTSITVGVEVAAVVLTSLMLANILRT 158
gi 223996507   37 DDARRAVDEKAQQLKVLANQSALVAGFSMVVLVESNI-P-P-DINGALLTLFGGVTACVIALMLVSTLNATYMLVAILRY 113
gi 302781408   26 ELNRRDVEEKSEHLRSLSWITGLVTSFTMTAPVEFNT-P-K-SIRAGRLMPYAICTAIVPTLMTTSTIICVYLLGCILRM 102
gi 168014007  260 ELNRREVDEKAEHLRLLSWLTGLITSFTMTTLVEFQF-D-A-TVSTARLTAYAIFTALVPTLMTTATMISVFLLGSILKM 336
gi 397605067   37 DDARRAVDEKAQQLQVVANQGALFAGFSMVVLVESSI-P--EALNGALLAVFGSAVAMTIALFLVSTLNSTYILVAILRY 113
gi 302773678   85 EKNRRDVEEKSEQLKAISNLAALFAGFAVVTLTQFTIap--dpVLTVWIAFYGVLTAIAVGLMTISMVTCTLILGSILKN 162
gi 159479648  534 AKNRRDVDEAVEKLKVLAQLGALTAGFAVSAFYDFQYta---sPSDPVIPFFGLVTALTVGFELNSCVLCTLMLSSVVKA 610
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HKS_A         92 SNLHSIS--LVH---------------------ESPHERLHWYI------------ETAWAFS---TLL---G------L 124
gi 168033216  166 GKLYVNEeaEEEfmfmckafvr-nhrdnpdlkpPSPRRTFEAFWri--------rcETDWRRSfqlFAL---G------V 227
gi 168012498  209 GKLYVNEvaEEEfifqcrsfc---mnfelgdrpPCPKRTLEAFWel--------rcEKSWQRA---FLCfsfG------V 268
gi 159462636  159 AKSYVNEqeEAEfmhrcqafm---anyrpgdrpPAPVRTFAVHWar--------rcEHEWRIA---FRLfstG------I 218
gi 223996507  114 DCVN-------R---------------------EVP---FDEFWrk--------rcEPDWKMA---LRTfsyG------I 145
gi 302781408  103 GKSFVSEhaEEEfmalchsya---esaapsqppPVPSRTFQNFWaa--------rcKDYWNTA---FSLffwG------V 162
gi 168014007  337 GKWFVSEeaEEEfmaqcriyae--sahpsqlapPAPRRTFDRFWefrsimllirfkLDDFNAA---------G------I 399
gi 397605067  114 DCVR-------R---------------------DVP---FSEFWnk--------rcEPDWKIA---LRCfsyG------V 145
gi 302773678  163 GKSYVNEeaEEEfmfkcrdfv---ksyrtgdkpPSPRRTFEAFWei--------rcEDDWKRA---FQFfawGrplnsrV 228
gi 159479648  611 GKRYTSEeeEAEylwrlrdwaaaatggvpssvpPAPRRSFARHWes--------rcESRWRVA---LAMflaG------I 673
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
4HKS_A        125 ILFLLEIAILCWVKFYdL-SR--RAAWSATVVLIPVMIIFMaFAIHFYRSLVSHKYE 178
gi 168033216  228 LSFLVSLIPIGWIKFs-Y-SP--VTAGLFMGIVGISVIVWg-CVQYSWGTHMTSNIH 279
gi 168012498  269 SAFVCSLILVGWVTFAgE-SV--MTAGLFTFISCSSVIIWMa-IQYSWGSYTRKRKS 321
gi 159462636  219 PFFFVNLALAGWIKFHdAqTP--VAPIIVTLIMGFSLM-YNvYTHRKWGEYLMADGS 272
gi 223996507  146 PLFMVVVALVAWVSFWdH-ESlyYSASVVTAISVMVLILWFgSTERKWGEFLRMSDA 201
gi 302781408  163 SFFLALLCTMGFIKF--S-DD--RVALSFTTVIGISFVAWLg-IQVKWGYYLKKEYE 213
gi 168014007  400 TFFLALLCSLGFVKFW-F-SD--FIAIFFAVIIGIFFIIWLg-IKFTYGLYLRDDSA 451
gi 397605067  146 PSFLLVVSLVAWVTFWeA-ESgfVSASVVTTISMAVTLFWFgRTDRKWRGFLLMPEA 201
gi 302773678  229 LSFLFSLIPIGWIKFY---NSr-LTAGLFMGVIAVSIIVWG-FVQYLWGGYLTKTfr 280
gi 159479648  674 PTFFAVMGLAGYLKYW---NS--PATVVITAVLMAAAFVYTvGMTADWAKSLlgrrt 725
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap