Conserved Protein Domain Family
Nif11

?
pfam07862: Nif11 
Nif11 domain
This domain is found mainly in the Cyanobacteria and in Proteobacteria such as the nitrogen-fixing bacterium Azotobacter vinelandii. It is found in Nif11, a protein described in Azotobacter as linked to nitrogen fixation. It also constitutes a leader peptide in Nif11-derived peptides (N11P), which are thought to be post-translationally modified microcins derived from a putative nitrogen-fixing protein. N11P sequences have a classic leader peptide cleavage motif, usually Gly-Gly, which marks the end of family-wide similarity area and the beginning of a low-complexity region rich in Cys, Gly and Ser.
Statistics
?
PSSM-Id: 336841
View PSSM: pfam07862
Aligned: 135 rows
Threshold Bit Score: 29.3146
Threshold Setting Gi: 81573209
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 81574402    2 PSTAVQQFLLHLSRDPLLQVKVQAAITADEVAMLAQELGYAVSGSDL 48
gi 505028989   2 SLENVKAFYKQLASDEDFRTQIEGVENKEECSQIVKAAGYDFTQAEy 48
gi 501592473   2 SLVDVKSFYQRLAKDEAFRTQLQEVTSKEECSQLVQASGYNFTQEEF 48
gi 501450108   2 SLDDARLFIDRVRSDDDFSTRLSQTETIENRLRIARVEGFEFTIEEF 48
gi 501592474   2 SFENVRAFYERLAQDVEFRSELQEVKTKEECSQFVQQAGYNFTEEEF 48
gi 505028990   2 SLENVRDFYERLATDDDFRNQIQGVESRELGRQILQDSGYNFSPEEF 48
gi 503709193   2 SKKQAMQFLDRVETDANFRNQILSCQKPEQKEKILKKEKYTFSKKDL 48
gi 501378070   2 SIQSAKALYTKLLVDEEFRTKLEQTANQQERRQILQAGGFDYTPDEL 48
gi 501378225   2 SLEHVKAFYQKLANDEAFSNQIQGVNSKEECSQIVKAAGYDFTLEEy 48
gi 146274799   2 SIEKAREFIKRVKNEPDLLRQAACFQTREERRRWARGLGYDFTGEEL 48
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap