Conserved Protein Domain Family
CtnDOT_TraJ

?
pfam07863: CtnDOT_TraJ 
homologs of TraJ from Bacteroides conjugative transposon
Members of this family have been implicated in as being involved in an unusual form of DNA transfer (conjugation) in Bacteroides. The family has been named CtnDOT_TraJ to avoid confusion with other conjugative transfer systems.
Statistics
?
PSSM-Id: 311695
View PSSM: pfam07863
Aligned: 13 rows
Threshold Bit Score: 60.0323
Threshold Setting Gi: 81417235
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 81417168  272 FFLIGILGFFSVPTVSGWIIEAGGGiGNYGKNVNEQAKRAGGKALTGGKALSAAGGAVVGNALGRFR 338
gi 81417235   10 FLLIGIVGCYCVPTVAGWIIGAGGGiGSYERNVNQTAQRGTQGAYTGSKAMGGGAQVLLPVMSFDVS 76
gi 495781593 308 FLVIGIVGYFTVPNVANYIVHAGGG-NAMLQKVNTLVVGGTSTAASTAQTGAGMAADAMGNIYRRLK 373
gi 755128865 305 FMVIGIIGYFTVPSIANYIVHAGGG-GGLTQKITSMLSSSSRTTIAAASTGAGMVADTMGNAAskis 370
gi 495783430 313 FLLIGIVGYFSVPTVANFIVHAHGG-NGMLQRVNNIATGTTSTVISTSAAVGSATGERMAQGAKNIa 378
gi 495786438 302 FLVIGIVGYFSVPTVANYVVHAHGG-NGLMMRMSTIAAGGISTVTNTAVQGGAAAGERMGRGVGNMl 367
gi 916243361 294 FLLIGIVGYFTVPSTANYIVHAGGG-NTLVNKINSLVISSSRSATSAMS--GGMQADAYGNQRENVT 357
gi 373889591 317 FLVIGIVGYFSVPNVANYVVHAGGG-NTILQRVNTIVSNTSSTASGAAIAGGGMTADALGDAYRNIK 382
gi 146156506 307 FMIIGIIGYFTVPSVANYIVHAGGG-GALGHKVTSMFGNSASSVMRTSSNAVGMAADAMGDADRRMT 372
gi 495779765 307 FLIIGIIGYFTVPSVANYIVNAGGG-NGLLQKVNSMVSSTTQSVMSAGASGSSMVADAFGNQRTNTs 372
gi 543965237 145 FFLIGIVGYFCVPTVAGWIIEAGGGiGSYGRNVNQTAQHGAQGAYTGGKAAMAGAGAAVGNVGGRIK 211
gi 500936266 303 FMIIGIIGYFTVPSVANYIVHAAGG-GALGQKVTSLFGSSANSVVSRTAQGAGMVLDAMGDADTRMT 368
gi 917987382 305 FMIIGIIGYFTVPSVANYIVHAGGG-GALGHKVTSMFGNSASSVMRTSSNAVGMAADAMGDADRRMT 370
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap