Conserved Protein Domain Family
DUF1656

?
pfam07869: DUF1656 
Protein of unknown function (DUF1656)
This family contains bacterial proteins, many of which are hypothetical. Some proteins in this family are putative membrane proteins.
Statistics
?
PSSM-Id: 336843
View PSSM: pfam07869
Aligned: 125 rows
Threshold Bit Score: 29.326
Threshold Setting Gi: 489338220
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 81497938   4 QLDLYGIFLPSFAALALFAYGAFRVLASLLGKVGFYRAVWHRSLFNFALYIALVGG 59
gi 81725230   4 ELSWGDIYFSPTLLVLFLAVTATWITVMILNKTRLSRFIAFPSLTFIAIMVGYVVA 59
gi 81399751   6 ELQLGDIYYSPFLLVMIIAIIATWITVAILNKTRLSRLIAFPSITFIAISVFYVVA 61
gi 494963508  4 EIALGGVYVPTLLLLALVALVLSWGVTRLIGAFGLYRFLAYRAAVDLSIFVLMLGA 59
gi 505272775  4 EISIGGVFVPTLLMLAFVALLLTGFAVRMASLFGLYRFVAYRAMVDLAMFVLILGL 59
gi 504052201  7 EWAIGTVYLPPFLVAAALGLLLSWLTARLMNRYRLSRFLLYPPGVFVALAVIYTVI 62
gi 557030503  7 EFVIGGVYFPPMLIAATLGTAAAWLSAHLLNRYRLSRFFAYPPLVLLALAVTYTVL 62
gi 502814908  6 ELAAGDIYFSPLLLVLVMATMASWITVALLNKTRLSRFIAFPSITFMAITLFYVIa 61
gi 500722326  8 ELSLGDVYFSPILPVIFFAFLGAVVTVLILNKLKLSRFFYAPPYVFIAVMALYMVL 63
gi 557033766  9 ELSIGGVYLSPWLLIAIITILLSWLLADILNRLRWSRFFASPALVFLAMMAVNFVL 64
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap