Conserved Protein Domain Family
YabP

?
pfam07873: YabP 
YabP family
This family of proteins is involved in spore coat assembly during the process of sporulation.
Statistics
?
PSSM-Id: 336844
View PSSM: pfam07873
Aligned: 465 rows
Threshold Bit Score: 35.4039
Threshold Setting Gi: 524703660
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 123066478   3 QNITLKDRSKLVISGVEHIYSFNDKRVELKTSVGEMVIEGENLDMSKLSidENIISIDGTINSMVY 68
gi 122481900  23 PRITVTGRQEVLVENYLEIVEFTPEEILLHTTEGQLTITGKELVLKTVL--ATELWIVGQFTALAY 86
gi 493767328  24 PKITITGRQEVLVENYQDIVEFTTEEIRLSTLEGELCLTGRGFILKTVL--ATELRIEGELDSLTF 87
gi 908672290  39 PKITITGRSEVLVENYLSIINFSKEEIRIETAQGELFLSGKGLVLKTIL--ATELRIEGELDALRF 102
gi 504717632  24 PKITITGKRQIMVENYISILNFSEEEIRLETAEGDIFFRGKGLMLKVIL--ATELQIEGELSSFwf 87
gi 503390917  24 PKITVLGRHEIIVEYYREVIEFSEQKIELDTTDGKLSIRGSGFVLTAVL--PTEIHIKGIFHHLSl 87
gi 524697269  36 ltVELRGRNDLYITGCERILSYSAECIGLLVSGAELTVTGRRLCCTTYF--NAEIGINGEIDGLSF 99
gi 504857487  24 PKITIIGRSEIIIEYFDEVVGFSDQEITLRTSEGKLCLNGDKFILTAVQ--DHEISIRGRLTGLSF 87
gi 524526185  34 gmLEMRSRGEVMIHDCRRILLYTPEKICLLRGRETLAVCGEGLYCLSYF--GGTVLVRGKIRALfl 97
gi 524146763  17 yNIEMVENSRLLICGCVGVASYTRECARICTREDDIIISGCGLSLCWAG--EGKMLISGDLRTVTF 80
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap