Conserved Protein Domain Family
PHB_acc_N

?
pfam07879: PHB_acc_N 
PHB/PHA accumulation regulator DNA-binding domain
This domain is found at the N-terminus of the Polyhydroxyalkanoate (PHA) synthesis regulators. These regulators have been shown to directly bind DNA and PHA. The invariant nature of this domain compared to the C-terminal pfam05233 domain(s) suggests that it contains the DNA-binding function.
Statistics
?
PSSM-Id: 311707
View PSSM: pfam07879
Aligned: 74 rows
Threshold Bit Score: 75.2452
Threshold Setting Gi: 501004294
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 123527522  16 IIKKYANRRLYNTATSSYVTLDHLAHMVKDNSDFVVYDAKTGEDITRSVLTQIIVEEESKG 76
gi 81589547   14 LLKRYANRRLYDPETSKTITLEDVAEMIIKGEEIRVIDNMSGSDITPKILGQTFLKVSlgq 74
gi 504614363   3 IIKRYANRRLYDPETSRTITLDEVAQYVRDGVDIKVIDNTNGEDITRKVLGQTFLKLNEsd 63
gi 506389676   3 LIKKYANRKLYHTNQKRYITLDGIARLVQEGETVQVLDNETGDDITANILAQVVLHARGRq 63
gi 500594450   3 TIKKYANRKLYHIDRKQYITLEGIAALVQAGEQVRVVDNETGEDITAQILAQVALQTRGdq 63
gi 159890711   3 LIKKYGNRKLYHTNAKQYITLHGIAKLIRAGSDVRVVDNVTGEDLTVQTLSQILLNSKGrr 63
gi 506386277   6 HIKKYPNRRLYDTDKSAYVTLQDVSGLISDGHRVEVTDVKTGEDVTAFILTQIIMNKAKEa 66
gi 504771933   6 TIKKYPNRRLYNTKKSTYITLEDVSDLIKKGFRIQVVDVNTGNDVTSIVLTQIIMNKAKKD 66
gi 557033512   6 LIKKYPNRRLYDTKMSSYVTIADVADMIRAGNRVEVQDVTSGEDVTALVLTQIIMDKAKKN 66
gi 503716628   7 LMKKYPNRRLYNTATSSYVTLDDIRQLIKRGYDIAVVDVKTGEDLTKFTLTQIALEQQQDG 67
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap