4C20


Conserved Protein Domain Family
Fucose_iso_N1

?
pfam07881: Fucose_iso_N1 
Click on image for an interactive view with Cn3D
L-fucose isomerase, first N-terminal domain
The members of this family are similar to L-fucose isomerase expressed by E. coli (EC:5.3.1.3). This enzyme corresponds to glucose-6-phosphate isomerase in glycolysis, and converts an aldo-hexose to a ketose to prepare it for aldol cleavage. The enzyme is a hexamer, with each subunit being wedge-shaped and composed of three domains. Both domains 1 and 2 contain central parallel beta-sheets with surrounding alpha helices. Domain 1 demonstrates the beta-alpha-beta-alpha- beta Rossman fold. The active centre is shared between pairs of subunits related along the molecular three-fold axis, with domains 2 and 3 from one subunit providing most of the substrate-contacting residues, and domain 1 from the adjacent subunit contributing some other residues.
Statistics
?
PSSM-Id: 336846
View PSSM: pfam07881
Aligned: 50 rows
Threshold Bit Score: 161.266
Threshold Setting Gi: 973124380
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4C20_A        21 HPRIGIRPTIDGRRQGVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTIGRVPEAAASHELFKKSNVCATIT 100
gi 81553014    4 KYRVGLISFSDGREY-VHRELEGIVKKFEDEIAKTLEET------GEVEVIRAKEIVWKPSIAKREARRLAEEGAEVTIF 76
gi 524461733   4 KPKIGVIGFSDGEPE-VHEELKGIVQEQMDAIVKALRAS------GEVDVVEADYLVHSPEEAKLQGQKMVAEDVDGTIF 76
gi 488662698   6 LPKVGMITFSDAREH-------EYKVLYEEKTAARIKRTVEYFADYEMELHTFDTVARSPQDIDRQTDELKKKGVEVFIA 78
gi 295108782   3 KPVLGILGFSDGDKA-AHEMLKPIVQAQVDAIAEALKK------DGRVDVVVAEDIVHSDKTAKSYAEGLKAKGVDATVF 75
gi 524037815   2 lSKIGIRPVIDGRQFGIRESLEVQTMNMAKAAAELISSKVRHASGEPMECVIADTTIGGIAESAACADKFATENIVATLT 81
gi 524461824  12 FHKIGIRPVIDPRRA-VYQAIYGQTMEMARQAADLISSSICYPDGSPVECIVNPVCISDVTEAQHCTHFFATSNVGAILT 90
gi 505078007  16 KPVIGVFAPCDPR---IDAASRERSTNIIKHTAESLAGKIKLPDGTAAEVVYSDVLIDAESQADQVASQFKEAGVSVLVC 92
gi 973045583   2 KRKVGLMTFSDGREY-VHKDLININKAFEQKLVEALEST------GEIQVIRSNKIVNKPSVAREEAVFLNNSGAQMTIF 74
gi 973124380   3 KRKVGVITFSDGRDF-VHNDLIEMNKGFQDRLVKALEAT------GEVEVVTASDIVWKPSLAKKAGKELMKAEVEATIF 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4C20_A       101 VTPCWCYGSET-----M-----DMSPDIPHAIWGFNGTERPGAVYLAAVLASHAQKGIPAFGIYGRDVQEASDT-DIPED 169
gi 81553014   77 NYAVWAFPHFT-----VlaskfAPGPFLLFSNINPQ---YPGMVAMLSAAGALEQDGTKHYRMWG-NIKDE--------K 139
gi 524461733  77 SYGVFSFPNFSaiaakF-----GKGPFLLAANLNPD---WPGMVAMLAAGGALHHLGIEHFRAAG-DINDK--------E 139
gi 488662698  79 NIPCWTWPNGV-----VrgvlnMGLPTILLSNDDPG---THGTVGFLGSGGALNQIGYKHLRIQQ-DFTDEHPN-----L 144
gi 295108782  76 AYGVFAFPVFS-----ViaaryGKGPFLLAAPFNPD---WPGMVSMLAAGGGLDHEGIEHFRVAG-DVNEK--------E 138
gi 524037815  82 VTPCWCYVTQV-----I-----DENPNTIKAVWGFNGTERPGAVFLAAANSAYAQIGMPCFSIYGHDVKDADDA-VIPAD 150
gi 524461824  91 VACGWCYPFET-----F-----EFDSRLPHAIWGLNSTERPGAVYLAAAKSSGNLYGLPIFSIYGKDVQIDSSE-AIPVD 159
gi 505078007  93 VPDTWSFPQLT-----TislfsHFPKDTPINFTTGNSATRPGVVYTHATSGAIAQYGKLTHINVG-KWPDAGQNpEMSPA 166
gi 973045583  75 NYAVWAFPHFS-----ViaskfAPPPFLLFGNINPK---YPGMVGMLAAAGALDQDGTQTYRVWG-DIKQK--------D 137
gi 973124380  76 NYAIWCWPHLS-----ViaslyAPGPFLTYGQINPS---YPGMVGQLAAAGALEQVGIMPERVWG-NPEDS--------D 138
                        170       180
                 ....*....|....*....|
4C20_A       170 VKEKLLRYARAALATGLMRD 189
gi 81553014  140 VLRKVMAFIRAGSTYKKLRG 159
gi 524461733 140 VLDKVLQFAKCAHVVNSLKG 159
gi 488662698 145 FDTKMMPYIRAAAAVRKLQG 164
gi 295108782 139 VLEKIVTFAKCAKVVSSLSG 158
gi 524037815 151 VEEKILRFARCAAAVGDMKN 170
gi 524461824 160 VKEKILLFARCALGVSLMKD 179
gi 505078007 167 TLKALVDWCYAAVTFQGLKG 186
gi 973045583 138 VLRKVLAFVRAATARNMLRG 157
gi 973124380 139 VIERVMHFLRAASAAARLKG 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap