Conserved Protein Domain Family
Fucose_iso_N1

?
pfam07881: Fucose_iso_N1 
Click on image for an interactive view with Cn3D
L-fucose isomerase, first N-terminal domain
The members of this family are similar to L-fucose isomerase expressed by E. coli (EC:5.3.1.3). This enzyme corresponds to glucose-6-phosphate isomerase in glycolysis, and converts an aldo-hexose to a ketose to prepare it for aldol cleavage. The enzyme is a hexamer, with each subunit being wedge-shaped and composed of three domains. Both domains 1 and 2 contain central parallel beta-sheets with surrounding alpha helices. Domain 1 demonstrates the beta-alpha-beta-alpha- beta Rossman fold. The active centre is shared between pairs of subunits related along the molecular three-fold axis, with domains 2 and 3 from one subunit providing most of the substrate-contacting residues, and domain 1 from the adjacent subunit contributing some other residues.
Statistics
?
PSSM-Id: 311708
View PSSM: pfam07881
Aligned: 52 rows
Threshold Bit Score: 153.94
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4C20_A         21 HPRIGIRPTIDGRRQgVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTIGRVPEAAASHELFKKSNVCATIT 100
11_pfamImport   1 KPVLGILGFSDGDKA-AHEMLKPIVQAQVDAIAEALKKD------GRVDVVVAEDIVHSDKTAKSYAEGLKAKGVDATVF 73
37_pfamImport   1 KPKIGVIGFSDGEPE-VHEELKGIVQEQMDAIVKALRAS------GEVDVVEADYLVHSPEEAKLQGQKMVAEDVDGTIF 73
29_pfamImport   1 LPKVGMITFSDAREH-------EYKVLYEEKTAARIKRTVEYFADYEMELHTFDTVARSPQDIDRQTDELKKKGVEVFIA 73
21_pfamImport   1 KRKVGVITFSDGRDF-VHNDLIEMNKGFQDRLVKALEAT------GEVEVVTASDIVWKPSLAKKAGKELMKAEVEATIF 73
3_pfamImport    1 KRKVGIITFSDGRDF-VHEETLEMNKKFEDRLVKALENT------GEVEVVRASDIVNKPSKAKKAGKEMLKAEVEMTIF 73
gi 81553014     4 KYRVGLISFSDGREY-VHRELEGIVKKFEDEIAKTLEET------GEVEVIRAKEIVWKPSIAKREARRLAEEGAEVTIF 76
2_pfamImport    1 KRKVGLMTFSDGREY-VHKDLININKAFEQKLVEALEST------GEIQVIRSNKIVNKPSVAREEAVFLNNSGAQMTIF 73
12_pfamImport   1 -TPIGIVMMNDARPH-VYNLNNAENMAVVHGWADVIRQRFKNVDGSSPEVITASETITGVRVAQKIGEELRRANCRQVIM 78
36_pfamImport   1 FHKIGIRPVIDPRRA-VYQAIYGQTMEMARQAADLISSSICYPDGSPVECIVNPVCISDVTEAQHCTHFFATSNVGAILT 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4C20_A        101 VTPCWCYGSETM-----DMSPDIPHAIWGFNGTERPGAVYLAAVLASHAQKGIPAFGIYGRDVQEASDTDIPEDVKEKLL 175
11_pfamImport  74 AYGVFAFPVFSViaaryGKGPFLLAAPFNPD---WPGMVSMLAAGGGLDHEGIEHFRVAG-DVNEK-------EVLEKIV 142
37_pfamImport  74 SYGVFSFPNFSAiaakfGKGPFLLAANLNPD---WPGMVAMLAAGGALHHLGIEHFRAAG-DINDK-------EVLDKVL 142
29_pfamImport  74 NIPCWTWPNGVVrgvlnMGLPTILLSNDDPG---THGTVGFLGSGGALNQIGYKHLRIQQ-DFTDEHPN----LFDTKMM 145
21_pfamImport  74 NYAIWCWPHLSVmaslyAPGPFLTYGQINPS---YPGMVGQLAAAGALEQVGIMPERVWG-NPEDS-------DVIERVM 142
3_pfamImport   74 NYSIWCWPHLSVmaslyAPGPYLTYGQINPK---YPGMVGLLAAAGALEQIGIFPERVWG-EPEDP-------TVLEKLL 142
gi 81553014    77 NYAVWAFPHFTVlaskfAPGPFLLFSNINPQ---YPGMVAMLSAAGALEQDGTKHYRMWG-NIKDE-------KVLRKVM 145
2_pfamImport   74 NYAVWAFPHFSViaskfAPPPFLLFGNINPK---YPGMVGMLAAAGALDQDGTQTYRVWG-DIKQK-------DVLRKVL 142
12_pfamImport  79 CYNVWDFPYLVWpf-inSLGRDVPILSLSNNNGQYPGNVGLLATDGALRQAGIRTHRIVG-DMNDQ-------STQDQVL 149
36_pfamImport  80 VACGWCYPFETF-----EFDSRLPHAIWGLNSTERPGAVYLAAAKSSGNLYGLPIFSIYGKDVQIDSSEAIPVDVKEKIL 154
                         170
                  ....*....|....
4C20_A        176 RYARAALATGLMRD 189
11_pfamImport 143 TFAKCAKVVSSLSG 156
37_pfamImport 143 QFAKCAHVVNSLKG 156
29_pfamImport 146 PYIRAAAAVRKLQG 159
21_pfamImport 143 HFVRAASAAARLKG 156
3_pfamImport  143 KYIRAASAAHRLKG 156
gi 81553014   146 AFIRAGSTYKKLRG 159
2_pfamImport  143 AFVRAATARNMLRG 156
12_pfamImport 150 DWLRASEAYTTMH- 162
36_pfamImport 155 LFARCALGVSLMKD 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap