Conserved Protein Domain Family
Fucose_iso_N2

?
pfam07882: Fucose_iso_N2 
Click on image for an interactive view with Cn3D
L-fucose isomerase, second N-terminal domain
The members of this family are similar to L-fucose isomerase expressed by E. coli (EC:5.3.1.3). This enzyme corresponds to glucose-6-phosphate isomerase in glycolysis, and converts an aldo-hexose to a ketose to prepare it for aldol cleavage. The enzyme is a hexamer, with each subunit being wedge-shaped and composed of three domains. Both domains 1 and 2 contain central parallel beta- sheets with surrounding alpha helices. The active centre is shared between pairs of subunits related along the molecular three-fold axis, with domains 2 and 3 from one subunit providing most of the substrate-contacting residues.
Statistics
?
PSSM-Id: 311709
View PSSM: pfam07882
Aligned: 56 rows
Threshold Bit Score: 313.735
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_E        175 KSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGED-ENNKQYQRNA 253
19_pfamImport   1 KSYLGMGGVSMGIAGSIVNHDFLERWLGMRVETIDMVEFVRRIQYEIYDKEEFERAYAWVRANCVEGKD-YNPPDKQRSR 79
1_pfamImport    1 KAYLAMGGVSMGIAGSIVDHELFERYFGMRVESVDMTEFVGRIAKEMFDKEEYQRALAWVRENCKEGHD-WNAPEKQRTR 79
46_pfamImport   1 -SYLAMGGVSMGIAGSIVDHDFFQRYLGMRTETVDMTEFVRRMEEGIYDEQEYQQALQWVKEHCHEGTD-YNPPEKRRSR 78
16_pfamImport   1 KSYLSIGGCAMGIAGSIVDQDLLQSYLGMRTEAIDMCEIERRIVEEIYDHEEFKKAIKWVKENCIQPKDtVNEEKYRRSE 80
12_pfamImport   1 -SYLAIGGCSMGIAGSVVDQAFLQEYLGMRAEVIDMCEISRRIEENIFDPVEFKMAKEWVKKNITEAPDkVNPPQWQRSE 79
39_pfamImport   1 -TYLSLGTMSMGIASSVVSSDFLRNYLGMRTAYVDMSEMERRIQKKIYDPNEFKYAKEWVKSNLKIGED-HNPSANQKSA 78
4_pfamImport    1 KGYLSIGGCSMGIAGSIVDQSFWENYLGIRVQAVDMTEVRRRMDQKIYDEAEFDLAMQWADSVFKFAED-KNRPDLKLDE 79
3_pfamImport    1 -TYLSIGGVSMGIAGSIVDHAFFRSWLDMRVQAVDMTELRRRLDRKIYDTAELETAQAWADARFRFGIE-RN--ARPRDA 76
gi 123725458  176 RSYLSLGGVSMGIAGSIVDHHFFEAWLGMKVQTVDMTELRRRIENEIYDRDELALALAWAEANFRFGQD-TNAAEHRRSP 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_E        254 eQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVREPFV 333
19_pfamImport  80 aQKDEDWATSVKMALIARDLMIGNPKLREMGFGEEALGHNAIAAGFQGQRQWTDFLPNGDFMEAILTSSFDWNGIRPPFI 159
1_pfamImport   80 dQKDEDWETCVKMALVARDLMVGNPRLKEMGFAEQAQGHNAIAGGFQGQRQWSDHFPNGDFLEAILCSSFDWNGIRQPYI 159
46_pfamImport  79 qQLDRDWETCVKMALIARDLMNGNPRLAERGFPEEAEGHNALVGGFQGQRQWTDHFPNGDFLEAILNTSFDWSGIRQPYI 158
16_pfamImport  81 eQLEKDWEYCTKMTMIGRDLMIGNKELKKIGFGEESLGHNALFAGFQGQRQWTDHWPNGDFMETMLCTSFDWNGIREPFV 160
12_pfamImport  80 kQREADWDYCIKMTMITRDLMQGNLKLAEMGFEEEAEGHNAIASGFQGQRQWTDHWPNGDFMETMLTTSFDWNGIREPYV 159
39_pfamImport  79 eEKEKDWDECIKMAIIMKDMMEGNPRLSALGYEEEANGYGAICSGFQGQRAWTDFHVNADFMEAILNSGFDWNGQRPPFI 158
4_pfamImport   80 aGRRKTFRESVLMAMIFRDMMQGNPKLKKIDREEESLGYQAIAGGFQGQRHWTDFYPNGDIAETLLNSTFDWNGPRAPLP 159
3_pfamImport   77 aGKREILSESLAMTLCIRDMMHGNARLAAMGWAEEALGYDAIAAGFQGQRHWTDQYPNADVAEALLNSSFDWSGARAPSI 156
gi 123725458  255 eGYRGVLRESLQMTLCIRDMMQGNPRLISLGFTEEAQGYDAIAAGFQGQRHWTDQYANGDIAEALLNSAFDWRGVRQPLI 334
                         170       180
                  ....*....|....*....|.
1FUI_E        334 VATENDSLNGVAMLMGHQLTG 354
19_pfamImport 160 VATENDALNGISMLFIHLLTN 180
1_pfamImport  160 VATENDALNGASMLLGHLLTG 180
46_pfamImport 159 IATENDALNGVSMLFGHLLTG 179
16_pfamImport 161 MATENDFLNGIGMLFGKLLTN 181
12_pfamImport 160 VATENDHLNGVSMLFGKLLTG 180
39_pfamImport 159 ISTENDCMNAVTMLFGYLTT- 178
4_pfamImport  160 FATENDSLNGACLLFGYLLTG 180
3_pfamImport  157 LATENDCLNGATMLFGLLMSG 177
gi 123725458  335 VATENDSLNAVAMLFGHLLTG 355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap