Conserved Protein Domain Family
BA14K

?
pfam07886: BA14K 
BA14K-like protein
The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.
Statistics
?
PSSM-Id: 336850
View PSSM: pfam07886
Aligned: 61 rows
Threshold Bit Score: 41.2875
Threshold Setting Gi: 123512234
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|
gi 81633389   110 WYRYCSQRYRSFNPDSGTFVGYDGRSHFCN 139
gi 123162215  122 HIAWCSERYRSYDPVDNSYNAYSGETRECv 151
gi 123512234  104 HLAWCAKRYRSFEPATNSYRSYKGEIRECs 133
gi 75544212   212 HVRRCFDRYSSYDPDSDTYIGRDGYSHYCR 241
gi 123513338  102 HIAWCTNEYRSYNPRTDHFLTYEGVYRVCR 131
gi 81635306   142 HVSWCLSRYRSYNPASNRYLTYGGVYRVCY 171
gi 503418674  123 HVRWCLNRYRSYNPATDMYLGFDGRYHYCR 152
gi 1079357310 104 HVRWCMDRYRSYDPQTNRYIAGDGRMRVCR 133
gi 563751370  119 AVERCAARYRSFDRRTGTFLTYGGERRLCP 148
gi 502291686  230 lvAECARRFKTYDPQTQTYIVRRGVRRSCP 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap