Conserved Protein Domain Family
Calmodulin_bind

?
pfam07887: Calmodulin_bind 
Calmodulin binding protein-like
The members of this family are putative or actual calmodulin binding proteins expressed by various plant species. Some members are known to be involved in the induction of plant defense responses. However, their precise function in this regards is as yet unknown.
Statistics
?
PSSM-Id: 311714
View PSSM: pfam07887
Aligned: 73 rows
Threshold Bit Score: 260.927
Threshold Setting Gi: 475588067
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75272716    85 WKLAFRF--K-PQLPIFTGSKIEDVNGNPLEIILVDVDTG---APATISQP--LRVEVVPVLGD-FPpd-dREHWTAEEF 154
gi 514713228  143 cRLKFES--K-CCEDKYSGHVITADDGNPITVAIYDHD-N---KIIRNGPLssLQVKIVVLDGE-FNke-nKEQWSRESF 213
gi 721695347   58 YRMKFEN--R-CCNDKYSRHDITADDGNQIKVAIYDRDNG----IVTHGPLscMQVKIVVLDGE-FNna-nKKR-NRDYF 127
gi 1002848792 114 VQLRFVN--NnPKITQYTDSAVEWKNGKDVKVAVFENDNQ-----IKQGDLskVEVDIVSVHSDlFTkr-rQENFTKEEF 185
gi 1002256416  35 VKLFFVDveR-PEDPLFTGSPVQWQNGANAKVAIFEN--G---SQITQGGLskLQIEILPVHDD-FFtergPANFTKEEF 107
gi 475588067    5 lrqsqldvansvmerlpdilervlgehfgafkssimgciedkvqsivqtkmqeqkaaslpsavyeppprhvsegfpetgs 84
gi 475597422   98 YKLRFLN--G-LSNEIFTKKGIRAANGDPLKICLEDNNQQ----ENNSHRLlsAKIKIVVLDGD-FNid-nEDCWTLENF 168
gi 1002873918 127 YKLRFTN--G-LSNEVFTKKGICDVNGEPLKISVDADDPQ----DAGSHRLfsAKIRVVVLDGD-FNkn-dQGCWTSEEF 197
gi 721673560  106 YQLMFLN--G-LK-PVYTMMKLEAKDGSALKVALVEKLENdqtRIVRSGHLcsVRVEVVVLHGN-FNak-nEECWTPEEF 179
gi 1002314496 108 YQLVFLN--E-LK-PVYTLMKLEAKDGPGLKVAIVERLENnqmRIVRFGHLasAKVEVVVLHGN-FNak-nEEQWTPEDF 181
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75272716   155 qQRGI-VKERSGKRPLLTGDVSLTMRDG----CVVV-NELQFTDNSSWVRCRRFRIGVRVVpgsydGPRIGEAMTEPFVV 228
gi 514713228  214 -LNNIrVYGRTGKPPLLASELYVRLENG----VANL-CGIKFQDN---VPSRKFRLGVMEAdd-riSETILEGISEPFTI 283
gi 721695347  128 -RRKI-VSGRTGKPSLFSENIYLRLENG----VADL-HGVKFQDNSSWLPSKKFKLGVMVDdd-siPEDIQQGISDSFAV 199
gi 1002848792 186 -DKQI-CR-SGHKELVLA---AFNLNNG----EGSL-DSICFTESS---HGKEWRLAARVKtq-vpRVRFEEAVTDPFVV 250
gi 1002256416 108 -NKQI--YMCKGKESVLK---TVNLTNG----EANL-GSFFFTESS---HGKRLRLAARVKyq-dlAVRVQEATSYSFVV 172
gi 475588067   85 dtgvvklrfdvagpkdtlftrcpvwKNGanakVAILqNETQITQESS--HGKKLRLTARVKrq-dlTVRVQEAITDPFVV 161
gi 475597422  169 -SRHI-VRPRDKIGAVLTGELELSLKNG----KADL-RDATFIDNSKFTRSGKFRLGVMVVde--lGERILEGVTEPFTV 239
gi 1002873918 198 -TNRI-VRPRDKVGAVLTGELELSLKDG----EAHI-HDATFVDNSKFMRSGKFRLGVMAIdd--lGERIQEGITETCFV 268
gi 721673560  180 -SKHI-VWGREKSRKLLTGDLTLKLSEG----VASL-ENANFTDNSSFTSTKKFRLGLRLVnp--sGERVLEGITDPFRV 250
gi 1002314496 182 -SKQI-VCGREKSAQLLTGNLTLKLNGG----EALL-ENATFTDNSSFTSTKKFRLGLRLAnn--sEDRVLEGITEPFRV 252
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75272716   229 RDHRGELYRKHYPPVLGDDVWRLEKIGKEGAFHRKLTQHNVRNVQEFLRLLTVKPDELRAIMGdgMTDRMWEVTTSHAKK 308
gi 514713228  284 KSGRGFSYRKDPHPSLSDPIYKLHKIQENGDRHRLLEKMHINQVHDFLRFYNKDANSLRAACKn-ISDHDWNTIVNHALS 362
gi 721695347  200 KDGRGYAAKKDPSPSLSDPVYKLKEIAENGKRRKLLEQKGIETVQNFLWSYNKDKNNLRKDCGn-ISDHDWDVIVVHAQS 278
gi 1002848792 251 KVDRSKTYAKSYPPLKEDDVHRLVGISPKGKFRDNLVGKGIANVKQLLRHYYIDGSALQELIG--MKNRAWKDMIDHAKT 328
gi 1002256416 173 KDRRSKLNKKSNSPSKEEGIHCLKKISLKGKRCNDLAGKYITKVKHLMRCYHRDPAGLQKLt--gMKNEDWNTMISHATT 250
gi 475588067  162 KDRRSESNEKSPIPSKEDAIHQLKKICLKGKHWNNLVEKNITKVKHLLRHYHKDNFGLQKLa--gMKKGDWNTMIEHATM 239
gi 475597422  240 KDRRGEGSQKHAIPSLDDDVWRLQKISKDGVFHEALKGSGIFSVKDFLTSYYKDEHTLRKVLKk-ATKLVWTTIVDHAKK 318
gi 1002873918 269 KDRRGEGSRKHEIPLLDDDVWRLKKISKDGVFHEALKKSGISNVKNFLRLYYTDEHALRKILIk-ATDKIWTTIVEHAKK 347
gi 721673560  251 KERRVEGFEKHYPPLLHDEVWRLEKIGRNGAYHQALSNSGIDTVQKFLQSYVKNEQKLLQTFSk-MSQAAWKRIIGHAMT 329
gi 1002314496 253 KERRVEGFEKHYPPMLDDEVWRLEKIGRNGAHHQALTNSGVDTVQKFLQSYFTDEKKLFQTFSk-MSQAAWKTIISHAMT 331
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 75272716   309 CVPGDKVYMY--STQHGTVYVNSIFELVKVELAGVeyq--lhqLNRGQ--KAFVHQLLLAAYEQRNNLQEA 373
gi 514713228  363 CKPGHRHYSYhiPAKDATMFFNSLYKIVGAEFNGKyts--yeeLNDTQ--KGLVEVSKKKAYDNLKLVQYe 429
gi 721695347  279 CNQEHIQHSYyiQEGNATVLFNSLYCITGADFGGIyts--yenFNKAQ--KDLVKKYWTTAYDNLEVVQYe 345
gi 1002848792 329 CHPGNELYYYtaMEKNYELCFNDFYELVGVKRDGKyta--ycnLDHSQ--QRKVNNWKKSAYKKFEDLEKN 395
gi 1002256416 251 SDPGDEIHSYr-vEKNTIIFFNDFFALVGMSVDGSyapyhannLNQLQ--QRKMNKWKESAYQKFEELEKl 318
gi 475588067  240 CVPGDEIYSYlvPEDNCQILFNDFYDLVGKMTDNyvp---ysvNDADQfpQHKVKNWKMSAYKKFEELENS 307
gi 475597422  319 CDPGKELYSFivEGHDVVLFFNCFYRIVGVTSSDQytp--fkdLNQRM--Qivqsemfmklmvikdasfdi 385
gi 1002873918 348 CDPGRQLYSFm-ENNNVVLFLNSVCQIVDVKQGDQyip--fseLDRTL--QDKVGQLRKSAYENVTQLIPI 413
gi 721673560  330 CKVSNRLCLYeiKEKNMELFFDDIVQLVGVKFGDCykp--ldqLHQAE--KNLVETLKQLAYQNMKDIQYA 396
gi 1002314496 332 CEVGDDLCLYevKGNNVGLFFDAIYQLVGVKFGDSykp--ineLDEIE--QSAVETMKQLAYANISGIQYD 398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap