Conserved Protein Domain Family
DUF1666

?
pfam07891: DUF1666 
Protein of unknown function (DUF1666)
These sequences are derived from hypothetical plant proteins of unknown function. The region in question is approximately 250 residues long.
Statistics
?
PSSM-Id: 311718
View PSSM: pfam07891
Aligned: 47 rows
Threshold Bit Score: 266.748
Threshold Setting Gi: 769814578
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75170913    349 ELENVYVGQMCLSWEILHWQYEKAIELLESDVYGSRR--YNEVAGEFQQFQVLLQRFLENEPFEEPRVQHYIKRRCVLRN 426
gi 731373661   648 DLEMIYVGQLCLSWEMLQWQYGKALELQEYDPDGFRQ--YSEVTSEFQQFQVLVQRFIENEPFQGPRVQCYVKNRYLIHK 725
gi 586644362   784 ELETVYVGQVCLSWEFLQWQYLKFREVRE----RPYS--YDQIAMEFQQFQVLLQRFMENERFeGPRIQNYVNNRCVLRN 857
gi 460386225   605 DLEIVYVGQICLSWEILYWQYGKAKDLLEHDPHEYHT--YNQVAGEYQQFQVLLQRFVEDEPFQGPRVQYYVRKRCILRS 682
gi 1000958327  430 DFETIYVGQLCLSWEMLHWQYWKVQELQKYDSQGSHH--YNQVAGEFQLFQVLIQRFIENEPFQGPRVQNYVKNRCVLRS 507
gi 571564064   426 DLELVYVGQVCLSWEILCWQHKKVQELKQYDSQWPRS--YNLVAGDFQLFQVLMQRFLEDEPFQGPRIQNYVKNRCVIRN 503
gi 947122516   636 DLELVYVGQVCLSWEILCWQHKKALELQQYDSQGSHShrYNHVAGEFQLFQVLVQRFIENEPFQGPRLQNYVKNRCVIRN 715
gi 695045209   432 DLEVVYVGQTCLSWEFLRWQYEKARELPESDPYRSNH--FNQVAGEFQQFQVVIQRFVENETFQGPRLPNYIRNRCVLRN 509
gi 695044502   615 DLEMVYVGQTCLSWEFLRWQFEKARQISDSDPYRSHQ--YNQAAGEFQQFQVIMQRFIEDEAFQGPRLPNYIKTRSAFQN 692
gi 695013806   506 DLEMVYVGQTCLSWEFLLWQYEKARELPQSARYRNHQ--YNQVAEEFQQFQVILQRFIEDEFFKGPRLPNYVKHRCGNQN 583
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75170913    427 LLQIPVIREDGNKDKKNGRRRDYeenndGVIKSDQLVEIMEETIRLFWRFVRCDKLTSSIHdQKSRTKSQIEPdheEDSE 506
gi 731373661   726 LLQVPAIKDDCIKDKKEMIETGQd-----AITIAMLTEAIEKSMHVFWDFLHADKH------VKGLQGNQVDL---QSPA 791
gi 586644362   858 LLQVPLVKEGESQERERTSNENK-------ITSTRLVEIMEESLRVFSEFVRSDREDAPTV-LKGFLRPQIEF---HDPT 926
gi 460386225   683 FLQVPSIRDDRFKGKKGGREEEKd-----VISIMKLGDVIKETMQVFWEFLRADKREANLA-LKGVQGTQM------DNA 750
gi 1000958327  508 LLQVPLVKDDCIKDKGKRGDEGQ-----HAITSPTLRGIIELSMQVFWEFLRADKDESNVT-FQGNLQAHPNL---QDLV 578
gi 571564064   504 LLQVPVIKDDNTKDKKIIKLGEE-----HAIDSERLAQIIKESMRVFWEFVRADKDYGNVI--KISHQIGVDV---KDPA 573
gi 947122516   716 LLQVPGIKDDSKGDEEE-----------DAIASGKLADIIKESMRVFWEFVRADKDYGNVI-FKASQHNRIDL---KDPI 780
gi 695045209   510 LLQVPLIREDGAREKMEDHQKGC-----YDITSEMIEDVMEESIRIFWEFVKADKDETPGI-LKGFMGAHVDL---QDPS 580
gi 695044502   693 FLLVPVIREDSLKEKLEDQRKGN-----YVITSEILEDIMEESIRLFWEFVKADKDETPGI-LKGLMGTHVQP---HDPS 763
gi 695013806   584 LPQVPHIREDNLKEKMEAQLKGN-----HIICSEVLEEIMEESIRIFWEFVKADKDETPWM-LKGLLGTHVQL---QDPA 654
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75170913    507 DLEMFAEVKSQLQNKEKRLRDVLKSERCIIRRFQKHKEEDS-TeDqvlHFFSQVDMKLVTRVLNMSKLTRDHLVWCHNKL 585
gi 731373661   792 DVELLMDIQTGLHKKEKKLKELLRSKNCIVKRLQKHREDRL-DrS---LFFAKVELRLISRALNMSRLTTDQLAWCQKKL 867
gi 586644362   927 DAELFTQIQATLAKKERRIRDLQRSGTCLIKKFNHKQDDGSnQ-T---ILFSQIDMKLVSRVLKMSKLTTDELVWCQKKL 1002
gi 460386225   751 EIELFMNVKLDLQKKERKLKDVQRSGNCIVKKFQKQQERRL-SpS---LFASLVELKLVSRVLSLPRLRRDHLVWCQRKL 826
gi 1000958327  579 DLELFTDVRTDYQKKDRKLKDISRSGNCIVKRFKKQQENGM-HqT---LLIAQVEMKLISRVLNMAKVTTDQLIWCHEKL 654
gi 571564064   574 ISDLLGNVRTQLQKKERKLKDIVRSGNCIVRKFQKHHEEQI-QlDe-eQLLAQVGLRLVSRVMHMKKLRKDQLMWCNEKL 651
gi 947122516   781 ISGLMVDIKTQLQKKDRRLKDIVRTGNCIVKKFQKHHEDQL-DhE---QLVAQVGLRLISRVVNMSKLRKEQLIWCNEKL 856
gi 695045209   581 DFDLMEDIQSDLRKKEKKLKDIVRTGNCIVKKFKRPKEDRS-NqD---LFFSQVDLKLVARVLRMSTITTDQLVWCHKKL 656
gi 695044502   764 DSKFMADIHSKLHKKERKLKDILRTGNCLVKKFKKPKEDRS-NqD---IFFSQVDLKLVARVLRMSRITTDQLVWCHAKL 839
gi 695013806   655 DFKFMANVQSNLQKKEKKLKDILRIRNCLVKKFKKPKEDGS-NqD---LFFSQVDLKLVARVLRMSRITTEQLVWCHTKL 730
                          250       260
                   ....*....|....*....|.
gi 75170913    586 TKINFVNRR-LHLDPSFCLFP 605
gi 731373661   868 SQINIVNRK-IHVEPSFMLFP 887
gi 586644362  1003 DRIHLKDRK-VYREPSFLLFP 1022
gi 460386225   827 SNINVAGRK-VSMEQSFSLFP 846
gi 1000958327  655 DKINISNRK-VFVESSFLLFP 674
gi 571564064   652 NRIKFDGRK-VQVEPSFLFFP 671
gi 947122516   857 HRIKFLSRKiVQVEPSFLLFP 877
gi 695045209   657 SKIRMVERK-IYREPSFLLFP 676
gi 695044502   840 SNISFIEGR-VHREPSFLLFP 859
gi 695013806   731 SNIVFIEGK-VHREPSFLLFP 750
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap