Conserved Protein Domain Family
DUF1667

?
pfam07892: DUF1667 
Protein of unknown function (DUF1667)
Hypothetical archaeal and bacterial proteins make up this family. A few proteins are annotated as being potential metal-binding proteins, and in fact the members of this family have four highly conserved cysteine residues, but no further literature evidence was found in this regard.
Statistics
?
PSSM-Id: 311719
View PSSM: pfam07892
Aligned: 186 rows
Threshold Bit Score: 72.4217
Threshold Setting Gi: 524321096
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541703   37 GINYAKKECTNPKRIVTSSVYIEDGEIDILPVKTKEDIPKSKINECMKSLKGLVVKAPVKIGDVIAENICDTGVDIVATR 116
gi 504041404  47 GEEYAKQEHTEPRRMVTTTVRVNNGIWAKLPVKTTAAIPKEKVIELCQQLRQVNVTAPIHIGDTILSNVFDLGVDVVASR 126
gi 504245521  42 GKEYAIQEHTAPQRMVTTTVAIDNARWPRLPVRTSKPVPKEKVLDICRTLRTVRVCAPVASGDIIVRNILNIGADVIATR 121
gi 823700957  37 GDTYARDEVVRPVRMVTSIVRVKNGKLKMLPVKTKEPIDKSKIPECLEALKNIEVQAPIHIGDIILHNV--TGSDIIATR 114
gi 524228789  36 GVTYAINEVTSPKRMVTGSVHVENGTIPMVSVKTREAIPKHLIFQGLELLKNVTLKAPVHIGDVAVSDICGCGVDFIVTK 115
gi 500163947  40 GKEYAIKEVKMPMRTLMTIVKCRGGDLPVVSVKTSKPIPKNKLIEVSKYLANIVVEAPVEIGDIIVRNVLGLNVDIVATR 119
gi 524098016  37 GDTYARAEIVRPVRMVTTIVKVENGKLKMLPVKTKEPIDKDKINICLHALKDIKVKAPVNIGDIIAKDIA--GVDIIATR 114
gi 502258833  35 GKQYAIDELVSPKRVLTTNVKVVDGELELVSVKTSRPINKDIIINKMKEIKRVAVKAPVKVGDVIVEDLDGKGTALIATR 114
gi 524148085  37 GETYGITEMTAPKRVVTSIVKVDNREDAFVSVKSAAPITKSKMFEAMDIIRAATISAPVKIGDIVIKDILGE-TDIIATs 115
gi 501578117  35 GKSYAEEEIKSPKRVLTTTVKIKNGKYNVVPVKTTGPIPKDYLFELLKKLADIEIEAPVPQGFKVLEKVYQE-VDVVTTR 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap