Conserved Protein Domain Family
DUF1669

?
pfam07894: DUF1669 
Protein of unknown function (DUF1669)
This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this.
Statistics
?
PSSM-Id: 311721
View PSSM: pfam07894
Aligned: 63 rows
Threshold Bit Score: 310.23
Threshold Setting Gi: 47224030
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 311033380  17 RVPGASPGFLYSEGQRLALEALLSKGAEAFQTCVQREELWPFLSADEVQGLAAAAedw--tvAKQEPSGMAEGatTTDVD 94
gi 224492936  18 KEQDSNLNELYNERHRLALEELVAGGVQSFMGFLKKERMPNFLSEDEIRRVSRAAvvpktisINGDDSHLDQS--GTLDC 95
gi 597738111  17 NIPESKPEFYYSEEHRVALEILLREGDGAFKTRLAEDKAKDFLSAREIKVIRSSV-------LQYDTNEETQEeeEEKRE 89
gi 47217308   17 RIPDTKPEFLYSEEQRCAVEELLRNGDGAFKLRLQSDNMTDFLSAREVKRILNTF-------RKYEPG-------EDEGD 82
gi 765112427  17 RIPESRPEFYYSEEQRVAIEELLKNGDGAFKTRLKEDKMIDFLSAREIKLLLSSF-------RQY----------DTESA 79
gi 542182174  17 KVPESKPEFYYSEEQRAALEQLLRNGDGAFKMRLQEDNTKDFLCAQEVKVIRKTF-------QEY----------DTDSD 79
gi 597798527  17 KIPESRPEFYYSEEQRAALEQLLRNGDGAFKMRLKEDNVKDFLSAREVRWIRDTF-------REY----------DADGE 79
gi 573898381  17 KVPESKPEFYYSEEQRGAVEQLLKNGDGAFRMRIKQDDIKEFLSSREIRRIRETF-------REY----------ETDGE 79
gi 557013701  17 RITNSKPEFYYSEEQRLAIQDLVEKGEEAFRERTKQEKIKEFLSSKESKRLRKNC-------QRYEVYEREEGapEGKGE 89
gi 432859499  20 kNDGPNLQELYNERHRLALEELLSGGIDNFLDFLKRERIPNFLSDNEIQAIGSAAvpprcvsLHGDDPALEQSlcSSMDC 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 311033380  95 Ag-----------------SLSYWPGQSEQPAPVLRLGWP-VD--SAWKGITRAQLYTQPP-GEGQPPLKELVRLEIQAA 153
gi 224492936  96 S------------------SVTYFPEVSDIEPPVLENGWP-AFttGSYRGVTRAVAYFQPSyGECIYSCKEAARRMIRNA 156
gi 597738111  90 TareaersargragdtpslRSTYWPQMSDTEVPGLDLGWP-HG--GFFRGVTRVAVHTHPP-KENGPHVKEVVRRLIQEA 165
gi 47217308   83 PqrspiksqqggadadsgvHSTYWPQMSDTEVPPLDLGWP-ST--GFFRTMTRVSVHTHPP-KDNGPHIREVVRRLIQEA 158
gi 765112427  80 Sstsptds-----hadsgvNSTYWPETSDTEVPSLEIGWP-SG--GLFKGVTRVAVHTHPP-KDNGPHLKEVARQLIQEA 150
gi 542182174  80 SesgehdkskgsssadsgvHSTYWPQMSDTEVPTLDIGWPgSS--GVYKGVTRVSVYTHPP-KEQGPHIKAVVRRLIQES 156
gi 597798527  80 Sepcgshapr-dpsadsgvHSTYWPTMSDTEVPPLDIGWP-SG--GFYRGVTRVSVYSHPP-KENGPHIKEVVRKLIQES 154
gi 573898381  80 DklgseppgaagskadsgvHSTYWPKMSDTEVPPLDIGWP-DT--GFYKGVTRVTVHTHPP-KENGPHIKAVVRRLIQEA 155
gi 557013701  90 Eqqa-------------egSLTYWPEQSDTEVPVLDIGWP-DT--GFYKGVTRITVHTHPP-KDNGPHIKEVVRKMIQQA 152
gi 432859499 100 S------------------SVTYFPDVSDVEPPLLEIGWP-AFtaGSYRGVTRAVAHFQPSyGESIYSCKEAARRMIRSA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 311033380 154 HKLVAVVMDVFTDPDLLLDLVDAATRRWVPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQVSG 233
gi 224492936 157 KEVIAIVTDSMTDLDIFHDLREACTRRRVPVYILLDQSSVASFLQMCKNLCVHLDELLQMKVRTITGSTYYMRSGARITG 236
gi 597738111 166 SKVIAIVMDLLTDLQILQDLLDASSKRRVPVYIILDIQGVPHFLDMCNRLQVNSQQLQYIRTRTVRGIGMGLSFG-RIPG 244
gi 47217308  159 TKVIAIVMDMLTDPQILQDLMDAASRRSVPVYIVLDDQGVPHFLDMCSRLQIGSQHLRNIRTRTLQGVGFNLSFG-RLPG 237
gi 765112427 151 SKVIAIVMDLLTDVQILQDLMDAACRRSVPVYILLDRQGVPHFLDMCSRLQIGAQHLLNIRTRILQGFGFNLSFG-KFPG 229
gi 542182174 157 HKVVAIVMDLLTDLQILQDLLDASSRRGVAVYVVLEARGVPHFLDMCSRLQINAMHLRNLRVRMLKGAGLALSFG-KLPG 235
gi 597798527 155 TKVVAVVMDLLTDLLILQDLLDAGSKRGVAVYLLLEEQGLPHFLDMCSRLQISAQHLRNLRVRTVRGSGLALSFG-KLPG 233
gi 573898381 156 RKVLAVVMDSLTDVQIFQDLLDASAKRGVPVYVVLDPAGAPQFTDMCHSLHINGRHLQNLRVRTVEGIGLALSFG-KIPG 234
gi 557013701 153 QKNLRVRSLPGVGL----SLscgrvrgtlshrfmivdgdkavsgsysftwsssrtnrnlinvltgqivetfdrefrelya 228
gi 432859499 161 KEVIAVVTDALTDLDIFRDLQEACTARRVPVYILLDQSCTPAFLKMCRNLGIRLDDLHLMRVRTITGTTYYMRSGARITG 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 311033380 234 TVREKFVLLDGERVISGSYSFTWSDARLHRGLVTLLTGEIVDAFSLEFRTLYAASCP 290
gi 224492936 237 KVHERFMLIDGNKVATGSYRFNWTDGKLNSSNLIELSGQITEKFDEEFRILYAQSLP 293
gi 597738111 245 SLCSKYMLIDGDKVMFGSYSFSWSSSRMDRNMITIMSGQIVDFYDNDFRELYAISEK 301
gi 47217308  238 SLCYKYMLVDGDKVMFGSYSFCWATFRTDRNMITVMTGQVVDFFDRDFRELYAISEK 294
gi 765112427 230 SLCNKYMLVDVDKVMFGSYSFSWCTSRMDRNMITVMTGQVVDFFDRDFRELYAISEK 286
gi 542182174 236 SLCSKYMLVDGEKVMFGSYSFTWSSSRLDRNTITVMSGHTVDFFDNDFRELYAVSEQ 292
gi 597798527 234 SMCSKYMLVDGEKVMFGSYSFTWTSSRMNRNTVTVMTGQIVDFFDNDFRELYAVSDK 290
gi 573898381 235 ALSSKYMLVDGEKVVSGSYSFTWTASRMDRNLITVMTGQVVDFFDHDFRELYAASLP 291
gi 557013701 229 isqevnlrtelniapvvisvpeptptppkvlppsssprlnttarrmlnpkyalvtgy 285
gi 432859499 241 EVHERFMLIDGNRVATGSYRFNWSDGKLNSSNLIELSGQISEKFDEEFRILYAQSLP 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap