Conserved Protein Domain Family
TPR_MLP1_2

?
pfam07926: TPR_MLP1_2 
TPR/MLP1/MLP2-like protein
The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.
Statistics
?
PSSM-Id: 336866
View PSSM: pfam07926
Aligned: 122 rows
Threshold Bit Score: 56.4489
Threshold Setting Gi: 927381677
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74607910    997 EEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEA----QSYKSDLETL 1072
gi 1091791497 1046 AETSGLRGEISQKVTQIESLGTQLSLLKEDLEREHKRWRTAQDNYERQVMLQSETIQELTKTSKEL----SLLQCEIAKL 1121
gi 224012309  1242 AKIDSLTVQLTGAKEDASKATARMESIMSEMKCYQLNATNAQNNYERELALHAEARTSLRDARALA----ESEQRLRETA 1317
gi 223541994  1055 SEIARLKEESSSKISQIMDLEAQVFAVKEDVMKEHQRWRAAQDNYERQVLLQSETIKELTRTSQAL----ASIQQETFDL 1130
gi 302813838  1012 KEVASLKNAEALKEGAIQQAEERIKVLKEDLRKEHQRWREAQNNYERQVLLQADTIRELSAVNEQL----ANLEQQENKY 1087
gi 927381677  1006 AKVGELGATIDSFDAVKKDYESQFAKLRDEMGSVQAVLREKQQ----EVAGKSDEWQQLVAEREKAqglvDELKQRVQGL 1081
gi 552824189   937 AEKQRLVAEAEAARADQAVQADQAARLREEVGLLRRQYQDAKRSYDNEVMQHGDALRRYAALETTF----NSLQQRLNEA 1012
gi 303282889  1067 KEAADAIAASTAAKAAVAAAEQKVAELAADVESHRAQWRSAQQMYEQELLHHAEDVKKLNAEEARR----AEEGKALETA 1142
gi 255084870  1056 AEAAEARRLAAEAEQNAAAAEGRVAALAADVEEHRKQWRQAQQMYEQELLHHAEDVKKLNAEEQRR----AEEAAAVEAA 1131
gi 1149752796 1044 NDITILRNEVSQKVSRIENLEVELASSKSALDEQCKRWRSAQDNYERQVILQSETIQELTNTSKQL----SSLQQEMAML 1119
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|...
gi 74607910   1073 KTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELL 1125
gi 1091791497 1122 QEVSDTIKTENEMLKTSWEKEKVTLQAMKDEAERKSNELNEQNKILLGQLESL 1174
gi 224012309  1318 EATLDSTKAEFDSEKSAWEAEKLRLEGSVQEAKSRLDDLRSQNNILFDQMTSL 1370
gi 223541994  1131 RKLADELRNNNSELKVKWDVDKSLLEESKKEAERKSKELDEQNKILLNRLEAL 1183
gi 302813838  1088 CEKAERAEAELESVKVTFFMEKASLDAHKADMEKRLQELDEQNRFLLDRLEAk 1140
gi 927381677  1082 EAQLADARADVSAAEERLEQEKQELVRELRAKEARVTELDVQNRTLINQLESr 1134
gi 552824189  1013 VLELDAARVSRGQAEAEAEVSRGELQQRAAEAERRAKALGEQRDVLQQQLEKa 1065
gi 303282889  1143 REKAREASDALAKAEDAWANERGVIEKAKRDAEANAAKLASQNALLHDRLEDA 1195
gi 255084870  1132 RELARAAEVRLAAAESKWADERGSMEKARRDAEAKTAALGSQNRLLHDQLEDa 1184
gi 1149752796 1120 RQTADAHKAENDALRTSGEQEKIELVKEKDEALRKYSELNDQNKILHNRLEAL 1172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap