Conserved Protein Domain Family
DAP_B

?
pfam07930: DAP_B 
D-aminopeptidase, domain B
D-aminopeptidase is a dimeric enzyme with each monomer being composed of three domains. Domain B is organised to form a beta barrel made up of eight antiparallel beta strands. It is connected to domain A, the catalytic domain, by an eight-residue sequence, and also interacts with both domains A and C via non-covalent bonds. Domain B probably functions in maintaining domain C in a good position to interact with domain A.
Statistics
?
PSSM-Id: 311746
View PSSM: pfam07930
Aligned: 22 rows
Threshold Bit Score: 240.644
Threshold Setting Gi: 115502141
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81351974   341 TQQPTALYGTYLERETGLSARI--EPAP-G-G-AKLRYLMVPE--LLEGISATRAEAGSVVVkaqeTAEG---------A 404
gi 167012042  340 VAADAVWFGSWLDHETGLVLSL--EDAG-R-GrMKARFGTGPE--MMDVVGENEARSSMTAI----RRDG---------D 400
gi 115502140  340 AQANPGWFGSWLNPETGLVLSL--EDAG-G-GrMKARFGTGPE--IMDISGENEAQSSMTTL----RRDG---------D 400
gi 115502141  337 GARPEGWAGQWLDPESGLLLRV--GEDA-E-G-LTLRFATGPD--RLTAGEDGVPRGAGVSL----AREG---------A 396
gi 1030143973 353 sTPAPEWQGNFLDTETQLLVHV--ENIE-D-GqVSITYHMATE--KVPLTSAIHAESKSIIA----NIAG---------D 413
gi 525586462  351 VEPAPAWYGAYLDEATQLAVTV--AKSRrP-GeVLITYGSHLEsaPLKMTDATSGKSRSMTG----SISG---------D 414
gi 398411614  351 ITPSPKWTGAYLNPQNNLLLTVvpSPGK-P-StLSVTYAVAPA--EVTLASPTTAESAGMLA----SIAPssssdvspqQ 422
gi 953388405  354 VQATADWVGAFLDQDTQLSIVI--TKGA-QdGeVAITYDGSAD--TIKLSTPNHGRSNSAVA----TVDG---------D 415
gi 631375978  346 HAPSPEWNGSFLDEATQLLIKV--ESEN-D-KeVVIAYAGHEE--KPQLTGPSTAESKTMLA----SING---------D 406
gi 889761055  341 TQQPLELYGTYLEQETGLSARI--EPTP-G-G-AQLRYLMVPE--MLEGVSPSRAETPNVRL----VRQG---------D 400
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81351974   405 EAVMERPGENRTSILARCDETpg----eDI-A--ELAGVYRCEELdEAEVTIE-L---AGGVVYGGFSGILGDGRMEMLQ 473
gi 167012042  401 TIHLAREDENLSLTMQRLKGA-------AK-Q--DIAGHYRSDEL-EADLLIV-D---EGGAFYGAFEGFLGKSDMYSLY 465
gi 115502140  401 MIHLARKDENLHLAMHRLKGE-------AR-Q--DIAGRYRSDEL-EADLLLV-S---EGGAIYGAFEGFLGKSDMYPLY 465
gi 115502141  397 MLVMNRTSDNLTVRAEPLPVVav----aDA-G--EIAGRYHAREL-EADLVIE-A---RDGGAYAGFEGLLGAGPMERLH 464
gi 1030143973 414 ELHVERQREHRTLNARRIKSPtt----tNStN--EYIGDYQCAEV-DSSFHCSpG---SGNLLYGSFDGFLGQGPAHLMQ 483
gi 525586462  415 TLQIHRISENRKLNARRLVPLds---glVD-P--KLAGAYYCDEI-ESTFYCT-G---EAGMFYGTFDGYLGNGIVTSMR 483
gi 398411614  423 NLSITRLRENTIFQARRLPEPsv----pPP-SsiDLAGEYHCAEV-QSSLRIT-SaskHSGLMYGAFSGFMGNGPVALMK 495
gi 953388405  416 SLSIHRVGDNRILSARRIAPKes---ilRD-N--SFQGVYHCTEI-ESTFHCN-G---EDGMLYGAFDGYLGQGHATPMK 484
gi 631375978  407 TLNIERKREHRMLKAARVPKVertdldgSV-E--ECIGEYRCEES-DSILRCT-G---AGGVLYGFFAGFLGQGPLHIMR 478
gi 889761055  401 EVRMERPGENRVGILKACDEAtg----eDI-D--ALEGIYRCEELdEAEVTVE-L---TNGAVYGGFSGILGNGRMEPLQ 469
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 81351974   474 RLAKDVWVLPCPRALDHTAPGDWTLAFER-QGGSVTAVRVGCWLARDLMYQ 523
gi 167012042  466 EAGPDVWLLPVQRSMDAPSPGEWKLVFHRdAKGEITGMTVGCWLARHVDYR 516
gi 115502140  466 AAGPDVWLLPVQRSMDAPSPGEWKLVFHRdAAGRITGVTVGCWLARGVEYK 516
gi 115502141  465 PVGPDVWIVTTRRSMDAPAPGDWTLQVRR-EGGAVTGLRLGCWLARRIDYA 514
gi 1030143973 484 YIGEDVWTLSNPRGMDAPAPGNWTIVFQRdENGKISGVTIGCWLARLIQFA 534
gi 525586462  484 YLGDDVWALGCPRGLDASAPGDWTMVFQRdESGTVSGFKIGCWLARGLDFV 534
gi 398411614  496 YVAGEVWTLACPRGLDAPAPGDWTCVFQRgDDGTVDEVTIGCWLARNLKFE 546
gi 953388405  485 YLGDDVWVLTCPRGLDAPAPGDWTIVFSRdEHNVIQGFTIGCWLARKVDFv 535
gi 631375978  479 PVAKDIWLLADPRGMDAPAPGDWTVVFGRgEDGHIKSVSVGCWLARRLGFV 529
gi 889761055  470 RLAKDVWVLPCPRALDHTAPGDWTLAFERdAIG-VNAVRVGCWLARDLVYR 519
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap