Conserved Protein Domain Family
DAP_B

?
pfam07930: DAP_B 
D-aminopeptidase, domain B
D-aminopeptidase is a dimeric enzyme with each monomer being composed of three domains. Domain B is organized to form a beta barrel made up of eight antiparallel beta strands. It is connected to domain A, the catalytic domain, by an eight-residue sequence, and also interacts with both domains A and C via non-covalent bonds. Domain B probably functions in maintaining domain C in a good position to interact with domain A.
Statistics
?
PSSM-Id: 336870
View PSSM: pfam07930
Aligned: 22 rows
Threshold Bit Score: 240.645
Threshold Setting Gi: 115502141
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81351974   341 TQQPTALYGTYLERETGLSARI--EPAPG-G-AKLRYLMVPE--LLEGISATRAEAGSVVVkaqeTAEG---------AE 405
gi 167012042  340 VAADAVWFGSWLDHETGLVLSL--EDAGR-GrMKARFGTGPE--MMDVVGENEARSSMTAI----RRDG---------DT 401
gi 115502140  340 AQANPGWFGSWLNPETGLVLSL--EDAGG-GrMKARFGTGPE--IMDISGENEAQSSMTTL----RRDG---------DM 401
gi 115502141  337 GARPEGWAGQWLDPESGLLLRV--GEDAE-G-LTLRFATGPD--RLTAGEDGVPRGAGVSL----AREG---------AM 397
gi 1030143973 353 sTPAPEWQGNFLDTETQLLVHV--ENIED-GqVSITYHMATE--KVPLTSAIHAESKSIIA----NIAG---------DE 414
gi 398411614  351 ITPSPKWTGAYLNPQNNLLLTVvpSPGKP-StLSVTYAVAPA--EVTLASPTTAESAGMLA----SIAPssssdvspqQN 423
gi 525586462  351 VEPAPAWYGAYLDEATQLAVTV--AKSRRpGeVLITYGSHLEsaPLKMTDATSGKSRSMTG----SISG---------DT 415
gi 953388405  354 VQATADWVGAFLDQDTQLSIVI--TKGAQdGeVAITYDGSAD--TIKLSTPNHGRSNSAVA----TVDG---------DS 416
gi 631375978  346 HAPSPEWNGSFLDEATQLLIKV--ESEND-KeVVIAYAGHEE--KPQLTGPSTAESKTMLA----SING---------DT 407
gi 889761055  341 TQQPLELYGTYLEQETGLSARI--EPTPG-G-AQLRYLMVPE--MLEGVSPSRAETPNVRL----VRQG---------DE 401
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81351974   406 AVMERPGENRTSILARCDETpg----eDI-A--ELAGVYRCEELdEAEVTIE-L---AGGVVYGGFSGILGDGRMEMLQR 474
gi 167012042  402 IHLAREDENLSLTMQRLKGA-------AK-Q--DIAGHYRSDEL-EADLLIV-D---EGGAFYGAFEGFLGKSDMYSLYE 466
gi 115502140  402 IHLARKDENLHLAMHRLKGE-------AR-Q--DIAGRYRSDEL-EADLLLV-S---EGGAIYGAFEGFLGKSDMYPLYA 466
gi 115502141  398 LVMNRTSDNLTVRAEPLPVVav----aDA-G--EIAGRYHAREL-EADLVIE-A---RDGGAYAGFEGLLGAGPMERLHP 465
gi 1030143973 415 LHVERQREHRTLNARRIKSPtt----tNStN--EYIGDYQCAEV-DSSFHCSpG---SGNLLYGSFDGFLGQGPAHLMQY 484
gi 398411614  424 LSITRLRENTIFQARRLPEPsv----pPP-SsiDLAGEYHCAEV-QSSLRIT-SaskHSGLMYGAFSGFMGNGPVALMKY 496
gi 525586462  416 LQIHRISENRKLNARRLVPLds---glVD-P--KLAGAYYCDEI-ESTFYCT-G---EAGMFYGTFDGYLGNGIVTSMRY 484
gi 953388405  417 LSIHRVGDNRILSARRIAPKes---ilRD-N--SFQGVYHCTEI-ESTFHCN-G---EDGMLYGAFDGYLGQGHATPMKY 485
gi 631375978  408 LNIERKREHRMLKAARVPKVertdldgSV-E--ECIGEYRCEES-DSILRCT-G---AGGVLYGFFAGFLGQGPLHIMRP 479
gi 889761055  402 VRMERPGENRVGILKACDEAtg----eDI-D--ALEGIYRCEELdEAEVTVE-L---TNGAVYGGFSGILGNGRMEPLQR 470
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 81351974   475 LAKDVWVLPCPRALDHTAPGDWTLAFER-QGGSVTAVRVGCWLARDLMYQ 523
gi 167012042  467 AGPDVWLLPVQRSMDAPSPGEWKLVFHRdAKGEITGMTVGCWLARHVDYR 516
gi 115502140  467 AGPDVWLLPVQRSMDAPSPGEWKLVFHRdAAGRITGVTVGCWLARGVEYK 516
gi 115502141  466 VGPDVWIVTTRRSMDAPAPGDWTLQVRR-EGGAVTGLRLGCWLARRIDYA 514
gi 1030143973 485 IGEDVWTLSNPRGMDAPAPGNWTIVFQRdENGKISGVTIGCWLARLIQFA 534
gi 398411614  497 VAGEVWTLACPRGLDAPAPGDWTCVFQRgDDGTVDEVTIGCWLARNLKFE 546
gi 525586462  485 LGDDVWALGCPRGLDASAPGDWTMVFQRdESGTVSGFKIGCWLARGLDFV 534
gi 953388405  486 LGDDVWVLTCPRGLDAPAPGDWTIVFSRdEHNVIQGFTIGCWLARKVDFv 535
gi 631375978  480 VAKDIWLLADPRGMDAPAPGDWTVVFGRgEDGHIKSVSVGCWLARRLGFV 529
gi 889761055  471 LAKDVWVLPCPRALDHTAPGDWTLAFERdAIG-VNAVRVGCWLARDLVYR 519
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap