Conserved Protein Domain Family
YhhN

?
pfam07947: YhhN 
YhhN family
The members of this family are similar to the hypothetical protein yhhN expressed by E. coli. Many are annotated as possible transmembrane proteins, and in fact they all have a high proportion of hydrophobic residues. A human member of this family, formerly known as TMEM86B, is a lysoplasmalogenase that catalyzes the hydrolysis of the vinyl ether bond of lysoplasmalogen. Putative conserved active site residues have been proposed for the YhhN family.
Statistics
?
PSSM-Id: 311756
View PSSM: pfam07947
Aligned: 77 rows
Threshold Bit Score: 64.5838
Threshold Setting Gi: 123253330
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74965441   33 SYSFWKITPIILLVAFAYLn---GG----GLGKEQRKTaAAGLFFGGVGDWIIG-MRHDGIILGAVAFGIGHLFYLSLYR 104
gi 82178728   38 FSALIKCLPIFCLWVFLLAhginFL----GAHSSARKI-LAGLIFSALGDAFLIwQEQGYFSHGLLMFAITHILYSSAFG 112
gi 82582292   46 VNVLLKILPVLYLAGFLGT----AH----PGGGYRALL-QGALLCSAVGDACLV--WPEALRYGMAAFGLAHLLYLRAFG 114
gi 296452936  48 FAALVKCLPVLCLAGFLWV----MS----PSGGYTQLL-QGALVCSAVGDACLI--WPAAFVPGMAAFATAHLLYVWAFG 116
gi 82582293   48 VSALIKCQPILCLVVFLWA----VA----PGGSSTWLL-QGALVCSAVGDACLI--WPEAFFYGTAAFSVAHLFYLGAFG 116
gi 81464542   26 LKIGSKIAPILVLIFFSFLe---GN----WKGKGGKFI-FAGLIFSLFGDAFLG-VPGNYFVFGLGSFLIAQILYSVGFS 96
gi 156405703  62 FAALLKILPIACLCGFVTL----QGvsltKQHDYSRRI-LLGLIFSMIGDVCLV-WKHSYFIHGMVAFAIAHLLYMRSFG 135
gi 113679367  39 wipdsapsllaagikaapilslvllvlsynggwslvgV-AGGLLLSAGGDCCLI-WPE-LFIHGMGCFALAHLLYSVTFL 115
gi 146231896  38 VSALIKCLPIFCLWLFLLAhglgFL----LTHPSATRI-FVGLVFSAIGDAFLIwQDQGYFVHGMLMFAVTHMLYASAFG 112
gi 969463734  98 WTTVLKCLPIVALMFYVVAngfsLK----KDYRRSLWI-LLGLVFSCGGDALLN---VNLFPFGMVSFGVAHVFYICAFG 169
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74965441  105 qh--atKIHTKFLLGMLAWALVIGQLCFIPMLADHr------gPLTVFASYSLLLSTCTLIAVSQYlngskS-------Q 169
gi 82178728  113 --------MKPLNSRAGLIIAVISGFSYTLLYPYLsg-----pFTYLVAVYIALIGFMGWRAIAGVqf-anD-------L 171
gi 82582292  115 --------LTPLKPGLLLPLLLVSALYFRVLHPHMpp-----qVVWPLLAYSIVLVAMLWRGLARGg------------- 168
gi 296452936 117 --------FSPLQPGLLLLIILAPGPYLSLVLQHLep-----dMVLPVAAYGLILMAMLWRGL----------------- 166
gi 82582293  117 --------LTPLQPGLLLCTTLASLTYYSFLLLHLeq-----gMVLPVMAYGLILNSMLWRSLVWGg------------- 170
gi 81464542   97 -------VGNPVHIIRAVPYLVFGISFYIWILPGIgt-----aLYVPVGVYMIAICVMGWRSVSR------E-------C 151
gi 156405703 136 --------FRPLKPLTGIICLLLMLPFYVFYFPNLkg-----lLFYAVPVYIVVIGIMVWRAITGLq----AqiysddgL 198
gi 113679367 116 ssryssTSSSFSFIFLYLVLWVFGVGIYVYLMPFLqldpeadvLVPAIGGYVLLIVIMATMA------------------ 177
gi 146231896 113 --------MRPLGLRTGLLMVILSGLCYAFLYPNLtg-----aFTYIVGVYVAIIGFMGWRAMAGLql-vgA-------A 171
gi 969463734 170 --------WKPLKWPIGLALYVAVSLFVYFVHQKLde-----iLIIGVPIYCYLITTMLWRALARAv----D-------A 225
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 74965441  170 NEEGLLYRAIGFFLFYISDSVLMLSHT-G-YWKLAPSFCVLSTYYSAQYFILFGN 222
gi 82178728  172 WTWTKLSACLGAVLFMVSDLTIAVNKF-C-FPVPHSRAIIMATYYAAQMLIALSA 224
gi 82582292  169 ------SAHWGALLFVLSDSVLAWNIF-T-YLVPHGHLLVMTTYYSAQMLITLSA 215
gi 296452936 167 --AQGGSAGWGALLFTLSDGVLAWDTF-A-QPLPHAHLVIMTTYYAAQLLITLSA 217
gi 82582293  171 ------SASWGAVLFTFSDGVLAWDTF-V-YSLPFARLVTMSTYYAAQLLLILSA 217
gi 81464542  152 SKSEFWKSLAGSLLFILSDSLIATRKF-TtVPIPWIGVWIMSTYYAAQFLIYESV 205
gi 156405703 199 WRWTKLCACLGALSFAISDAAIGLNKF-C-FPIPHSRAIIMFTYYGGQLGIALSt 251
gi 113679367 178 ARTRRPLILLGSLVFMASDLTIALTKFnV-VDTEYKRHIIMVTYYLAQLMIALGd 231
gi 146231896 172 WRWTELAAGTGALLFIVSDLTIALDKF-C-FPVPYSRALIMSTYYAAQMLIALSa 224
gi 969463734 226 KNFLAIFCAVGAVLFVVSDALIAVTMF-VgVPLPCPRLQIMITYYAAQFAIALST 279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap