Conserved Protein Domain Family
DUF1688

?
pfam07958: DUF1688 
Protein of unknown function (DUF1688)
A family of uncharacterized proteins.
Statistics
?
PSSM-Id: 336878
View PSSM: pfam07958
Aligned: 130 rows
Threshold Bit Score: 532.056
Threshold Setting Gi: 504243627
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028  14 LQSPQAVRDRCRLLLERVLAGESeHFRLDLNRMGSVADYVITTMRAHYPTGE---IPFHSRWQHFQVGS-----GERLAR 85
gi 81734861   12 LLTATAVRARAGQMLELGLKGELsHFTIDLDRMDGVADAVLAVTRKAYPTLD---VPFHARWRHFVLGG-----ADRWAR 83
gi 298708830  19 LRSLACIRERCGVIFDAAKSDKLaHFRLDLSKMDDVATFVQGLMDRDYSSYDd--VPYHSRWRHFEAGG-----LDRTAR 91
gi 500091475  34 LLCAKAVRSRCAAVMRHVEAGNSaLFTWQPQHLPATAAYVADTIRHDYPDLA---VPYHSRWRHFEAGG-----VDRWAA 105
gi 499838287  33 LLSAEAVRTRCAVVTDFVASGESeLFTWHPDRVHAIADYVAATIRRRYPTLQ---VPYHSRWRHFESGGpgqatINRWQI 109
gi 500300541   7 LLSARAVRERAHQLLALGLDDKLpHFRVDLGKLDAIADLVLDVTNKAYPSGE---VPFHSRWRHFVVGG-----TDRWTA 78
gi 359342185  20 LLNAKAVRERSHMLLELGLQGELeHFAVDLSHLAEAARRTLAATDNSYPDRQ---IPFHARWRHFETGG-----IDRWAM 91
gi 219945116  19 LLTPEAVRARAEGLLALGLDGGLeHFAVHPDRLGPCADAVVETIRAAYPDLD---IPYHARWRHFSVGG-----FDRWGS 90
gi 301118284  12 LRSLPSIREGCHRVLDLGKQDKLpNFSVVESKVPALADYVISVIRQLYPTPNeanVPFHSRWRHFETGN-----PQRVEK 86
gi 569368317  10 LRDLQTIRKQCERMYEMAKQDKLhFFGINLDKIESCAKEVVTCIKKHYPNLN---VPMHSRFRHFD--------PKAIEN 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028  86 LENRLK-DM--DPLE--RLRCKWDLAIVSVLLDAGAGSAWKYRDpesqTA---VGRSEGLALASFDWFWQGGFSSD-PqQ 156
gi 81734861   84 LADASS-WP--DRAA--RARAEFDLAIVSVLLDAGAGAAWRYRDavtgES---IGRSEGLAIASLDMFASGLFSSD-ArA 154
gi 298708830  92 LTAAWDgSKscDELE--KARRLVDLVVTSVLLDAGAGDVWKYTEk---STgfeAGRSEGLGVASFHMFGAGAFSSDtGsN 166
gi 500091475 106 LAARAGlDD--TPLE--RARVAFDLVIPSVLLDAGAGTAWRYRDg---ANglsLGRSEGLGVASFALFAGGGFSAD-PaR 177
gi 499838287 110 LCERAGmSG--PEHReeRARIGIDLVIPSVLLDAGAGPDWRYRDaasdMM---LTRSEGLGVASFDLFARGGFSAG-QgD 183
gi 500300541  79 VAEKTQ-WL--DAAA--RARAEFDLAITSVLLDAGAGASWRYQDavtgTR---IGRSEGLALASLDMFARGAFSAD-GrD 149
gi 359342185  92 LAGARR-FS--DVQG--MGRAAFDLAIVSALLDAAAGENWAYREaitgET---FRHSEGLAIGSLAMFSAGFFSDE-PlD 162
gi 219945116  91 LLQAAS-WE--DVAA--RARAAFDLVIVSVLLDAGAGPTWRYEEgrtgET---YARSEGLAVASFDLFISGLFSEA-PeD 161
gi 301118284  87 MTSTWHc----DKLE--KARRLLDLALVSVLLDAGAGPTWKYKEpgteDF---YSRSEGLGIASFHMFVAGNFSVDpEkD 157
gi 569368317  79 LRKKWTtHEv-DREE--QTRRLIDLAFISVLLDAGAGDEWKYVDrhg----rtLVRSEGIGAASLQMFLDGMFSSD-EaI 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028 157 PLQVDAAGLERITLADLAAAFQVGPE-NPLLGLEGRWQLLQRLAQTLRAqPHYF---GsghnlPRPGRLWDAIQp-EDp- 230
gi 81734861  155 PFRADADVLAKLPLAALTSAFQVSDA-NPLLGLDGRTDLLRRLGKQVADrAEVF---Glh-dtPRPGGLFDHIAa-QAv- 227
gi 298708830 167 PHRADSLGLKGLADDSVRRAFQVDDGvNPLVGCDGRTQVLKRLGTALEQhPVFFeagGi----FRPGNMVDYLLa-QAsd 241
gi 500091475 178 PLRSDAAALARLAPARLAEAFQASAA-NPLVGLEGRAALLRRLGEVMEAtPAVFg--Rp----ARLGHLVDYLAa-RAa- 248
gi 499838287 184 PLRSDADRLCRIDASTIASAFQVAQH-NPLVGLEGRAGLLRRLGEVMQDtPAVF---Gs---pARLGNLYDYLAs-HAr- 254
gi 500300541 150 PLRADAAKLRQLTVADLERGFQVGPD-NPLVGLEGRVALLRRLGEVTAAkPEIF---Gtq-daPRTGGLFDHLAa-SAt- 222
gi 359342185 163 PLRADSVTLFRLDKDELAEGLQVTDK-NQLIGLDGRLSLLNRLGEAVSLrDDLF---Gke-dePRPGGLFDVLYe-EGq- 235
gi 219945116 162 PFRVDARALASLTVADLAQGFQVTPT-NPLVGLEGRTALLNRLGQVVAAdPDGF---Gp---eARPGGLYDRLAa-RAt- 232
gi 301118284 158 PHRVDATALANLPDEAISDAFQVTDA-NPLVGCAGRTDLLKRLGKSISNyPEFFs--Gad-gsIRPGNMVDYLTkhQNa- 232
gi 569368317 151 KTRVNSRGLQKVSMQELKVGFQASKS-NPLVGLDGRAGLLKRLAKALEKfPEYFg--Hev---hRPGHLLDFLLvkad-- 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028 231 -sRGIKAAQVFQAVQRGFSSIWP-GRVSLAGIPLGDVWPYPHL-Pqt-epGs----HWVPFHKLSQWMTYSLLEPLQQEG 302
gi 81734861  228 -gGAIAAPAILSAVLNQLGPIWP-SRLELAGIPLGDCWRHPAI-Kad-daTa----GLVPLHKLSQWLSYSLIEPLQRAG 299
gi 298708830 242 dsKTVSITKVWEVVMYGFEAMWPaGRTELDGRSMGDVWEHSAL-PddgsgWs----NLVPFHKLSQWMTYSLMEPLQAAG 316
gi 500091475 249 -gRPLDAGEVLAVLLRALGPVWP-GRTVMDGVPLGDCWPHPALp------Gd----GLVPFHKLTQWLTYSLLEPLQQAG 316
gi 499838287 255 -eGRIEASFVLRTLLVALGPVWP-GRLQIQGISLGDCWRHPAA-------Pe----GMVPFHKLTQWLTYSLLEPLEDAG 321
gi 500300541 223 -gGHLQAADILQQVLLQLGPIWP-SRLTLQGVALGDCWRHPSL-Vad-dqTt----GLVPLHKLSQWLSYSLIEPLQRAR 294
gi 359342185 236 -sGPLDAERILEVVLDGLGPIWP-NREQIDGVILGDTWRHSKV-Taq-dkTd----NLVPLHKLSQWIAYSLVEPLSWAG 307
gi 219945116 233 -dGALPATAILSALLAHLGPIWP-GRITLDGVDLGDTWRHSRA-Gge-geTa----GLVPFHKLSQWLAYSLLEPLEEAG 304
gi 301118284 233 -sGEVSVTDLWKAVLNGLQDIWPaSRTQIDGQNMGDVWELSYL-Peh-ekAg----KFVSFHKLSQWMTYSLMEPLQDAG 305
gi 569368317 223 kdkkVSLHVLWKALIIGLEPIWPqRVSRI---RNGDVWSHNHLkI-----IgqpgsDMIPFHKLVQWLCYSIVEEFTNFG 294
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123501028 303 IPIGGLDELTGLAEYRNGGLFVDLGVIQLKQPEIG---------QQPHPPDSTVIVEWRALTVILLDQVASLIRERLG-C 372
gi 81734861  300 FAVTDIDGLTGLAEYRNGGLFVDHDVLRLRDAADA---------DRAHAVDSLLVVEWRALTVALLDRLAEPVRTKLC-R 369
gi 298708830 317 LVLTETELMTGLPEYRN---------GGLLLDMGLleakhpgvtGQAHGPEEEVIVEWRALTVCLLDEVAAALRQKLG-K 386
gi 500091475 317 FTISGVDRLSGLPEYRNGGLLLDFGVIAPRDPALL---------AEPLTVDSPAIIEWRALTVIGLDRLADAVRAELG-L 386
gi 499838287 322 LTVTGLDALTGLPEYRNGGLLYDFELMVPRDATFA---------SRAHAVDEPEIVEWRALTVTGLDLIADGVRQALG-L 391
gi 500300541 295 LVVDNIDGLTGLAEYRNGGLFVDGGVLVLRDPADA---------TRPHEVDSPLVVEWRALTVALLDRLAALIRERTG-Q 364
gi 359342185 308 IEMANIDGLTGLAEYRNGGLFMDTGVLRLKDPQQS---------LNKHEVSSELVVEWRALTIALLDKLADWIRADLS-V 377
gi 219945116 305 LTVTGLDALTGLPEYRNGGLFLDTGVLTLKRPEEA---------SRAHPVESELVVEWRALTVALLDRLAPLVRERLGiG 375
gi 301118284 306 FKITDLKLMTGLPEYRNGGLLVDFGVLVPKSANIL---------TDEFDPSTEVIIEWRALTVAILDELHKVILGRLN-F 375
gi 569368317 295 IKFDHLDDLTCLPEYRNGGLLIDTGVLVPKDTVDT---------DMTYHVGSELIVEWRALTVALIDEVAEHVRKQLG-K 364
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....
gi 123501028 373 SAQELPLVKILQGGTWTAGRQIAAQLR-PDASPPIQLLSDGTVF 415
gi 81734861  370 TPETLPLASILEGGTWAAGRAIAFARR-PDGSPPLKVISDGTVF 412
gi 298708830 387 TEKEFPLVKMLEGGTWKAGRYMAKTLRpQTCGPPIEIVSDGTVF 430
gi 500091475 387 SAASFPLPCVLQGGTWSAGRRIAADRRp-GGAPPLAILSDGTVF 429
gi 499838287 392 SEADFPLARVLEGGTWAAGRRVAAQRRpPGGPPPFAIQSDGTVF 435
gi 500300541 365 TPEQLPLARILEGGTWAAGRKLAFARR-PDGTPPLTIISDGTVF 407
gi 359342185 378 SRDQLPLACVLEGGSWAAGRQIALEKR-GDGSPPLMIISDGTVF 420
gi 219945116 376 DPADLPLAKVLEGGTWATGRRLARALR-PDGTPPLAIASDGTVF 418
gi 301118284 376 TADLFPLVKMLEGGSWKAGRVIAKEKR-ADGGPPIKIKSDGTVF 418
gi 569368317 365 TKSELSLSKILEGGTWRAGRELAYTLRp-TGAPPIRIRSDGTVF 407
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap