Conserved Protein Domain Family
CBP4

?
pfam07960: CBP4 
CBP4
The CBP4 in S. cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase. This family appears to be fungal specific.
Statistics
?
PSSM-Id: 311766
View PSSM: pfam07960
Aligned: 34 rows
Threshold Bit Score: 112.743
Threshold Setting Gi: 557729850
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 442570066   5 VWFRWLRVYAIGFGIIGAGVLLFKYTTPTDEELIAALSPELRQQYERERKLRQAEQQELMRIVKQTAASETPVWNTGPIK 84
gi 74633642   17 GVPNWPKFGLFAVGVIGSAYLGYRYATPSEEDIVRRMNPELRERYMLERDARQEYFNEFVKEAIAQSKTNEPIWKVGPMA 96
gi 187470662   7 NYKLWAKMILGGAGIAVGGPAFVMYISPTEEELFKRYNPDLQKRALESRYERQKEYDDFVTELKKSAKSDKNIWITQQI- 85
gi 218511965   6 LWYRWARVGVVGFSIIATGSLLFKYTVPTDEQLIAKFSPEIRAEYERNREIRQKEQQELMKIARETAASDDPIWKTGRIK 85
gi 754420383   5 LWYRWARVYAVGASIVGFGVVAYLYATPTDEELINRLSPELRAQYERERGLRRKEQEELIKIVKQTSASQDPIWMTGPIK 84
gi 575514293   7 rWKKVLRAGIYGNAVILLGVVLFKYTTPTEEQLISRFSPEIRADYEKNRSFRQQEQQELMKIVRETSQSSDPVWKTGKIK 86
gi 927381039   4 sWILWKRSLITGGGIIGSGVLLYKFTTPTEEQLIAKLSPELRADYERNKELRRKEQEMLMEIVKQTAASNDPVWKTGPIV 83
gi 254570445   7 syllwkksliygggiigtgVLLYKFTTPTEEQLIARLSPELRQEYEQNKSLRRKEQEELMKIVRETSKSNDPIWKTGPLT 86
gi 260944722   6 TWPKLGRMLLYGGGIIGTGVLLFTYTVPTDEQLIAAFSPEVRANYEKNKALRQKEQEELMKIVQETSKSNDPIWKTGKIA 85
gi 171683873   5 NWWLWTKMLVAGGGVIWGGPALVRYLQPTDEELFQKYNPELQKRSLERRYEREKEFDDFVVKLKEQAKSDKPIWIL---- 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 442570066  85 SPWER----------K----G---VSAES-REQFQQVKAEQVQREELQRIREELETIRQQSA 128
gi 74633642   97 SK-------------P----I---DFNVAvREKMKEIEARNDQDRN-ERIKNELAAIAKKEE 137
gi 187470662  86 ---------------E----A---EKKEKlARQMASANAAAEQARMQEEEHAKIEQMRREag 125
gi 218511965  86 SPFEKdg-------rN----T---DPKLVdIEKYNRERGDEFKKSEVERAQQELREAEELVS 133
gi 754420383  85 SPLEN----------H----G---TQLADvKQQYEKQVAEQKQLQEIEQIRAELEETQRKTk 129
gi 575514293  87 SPFEK----------D----TrglDPKLVdVKVFEKQEALAYQREQIDKSTEELAETEKLLA 134
gi 927381039  84 SPWDR----------DftpsR---ESLLVkRERFEKEQAEKKQREELERLKAEAKLVQTDES 132
gi 254570445  87 PSWESsatgptdrlpK----G---KELLVaKQAFEKSQAEEKQKEELRLLKKQVEETSQLES 141
gi 260944722  86 SPFEKet-------rG----A---DPKLVnATQFFKEEADAKKKAETERAEAEFLETERLVS 133
gi 171683873  81 ---------------Q----A---EEEKAsATNMARQQKLAESLRLAEEVKARREAMRKEag 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap