3N39


Conserved Protein Domain Family
Flavodoxin_NdrI

?
pfam07972: Flavodoxin_NdrI 
Click on image for an interactive view with Cn3D
NrdI Flavodoxin like
Statistics
?
PSSM-Id: 336885
View PSSM: pfam07972
Aligned: 63 rows
Threshold Bit Score: 122.602
Threshold Setting Gi: 20178017
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3N39_C        25 VYFSSSSENTQRFIERLGL--PAVRIPLN-----------EREr----IQVDEPYILIVPSYGGGGT--AGA-----VPR 80
gi 81585210    3 IRYISISGNTRSFVQRLTTysEEQHQHNEknpt---itfkEISensplEVETEPFFTFVPTYLDGGDgiNNGnt-eiLTE 78
gi 122641378   3 ILYISISGNTRAFAKHLAEyaEKMHAEDPvnpe---vtlkEIHensdfTKETEPFFTFVPTYLDGGNglDNGdt-eiLTE 78
gi 122264269   7 VLFISISGNTRAFAHRLAVyaQTQHDQNAanpt---ivlkEISdatqsDGETKPFFVMVPTYLDGGNgiDNGvk-elMTT 82
gi 122266389  20 IIYISVAGNTQSFVDDLADyaEKMHQNDTsnpl---iiskEVTdqtdfADETQPYFAFVPTYLDGGNgiDNGvk-elMTN 95
gi 122270528   6 ILFISIEGNTRNFVENLTAyaAKQHASQPelpe---itatEISetsdlTDETQPFFCFVPTYLDGGNgiDNGvk-elMTK 81
gi 123564963   7 ILYISLAGNTRSFVTDLQDyaQQQHTTNPalpt---ikltEISdatplKDETAPFYAFVPTYLDGGNgiDNGvk-elMTN 82
gi 122272415   6 ILYASTEGNTKAFIEKLAAvaESNGdgf---------sarLIGdeteyANETQPYVAFVPTYLTGGTgtGPEvk-eiFTN 75
gi 489763932   8 IVYMSFSGNVRSFTHRLQEyaTQQHHLNNenpl---idllEISeetlpTESDSKFFVLLPTYMIGGSrfT-PtlteiLTT 83
gi 489760995   6 IIYISLEGNTRSFLTRMQGyaKQQHSISEdrpllelkevsDqt---lpADETEPFFAFVPTYLNGGNgiDSGft-eiMTN 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
3N39_C        81 QVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIENVR 142
gi 81585210   79 VMREYLAFENNYRYCSGVVGSGNKNFNHQYCLTAKQYAEQFNFPFLADYELRGTQADIERIY 140
gi 122641378  79 TMREYLEHEDNHKLCLGVVGSGNKNFNNQYCLTAKQYAQTFGFPFLADYELRGTPSDVTRIY 140
gi 122264269  83 AMGDYLAEGENADQCIGIIGSGNRNFNEQYCLTAKRYAKEFDAPFLADYELRGTPSDAEKIY 144
gi 122266389  96 TLGEYIAYHDNRKFCLGVIGSGNRNFNEQYCLTARRYAQDYGFEMIDDYELRGNSSDCKRIY 157
gi 122270528  82 VLGEYIAYHHNAQQLLGVVGSGNRNFNEQYCLTAKRYATTFGVPFIADYELRGVPRDETRIY 143
gi 123564963  83 SLGEYIAYGHNADLCYGVIGSGNRNFNEQYCLTAKRYAEQFNVPFIADYELRGNSRDVGRIY 144
gi 122272415  76 ALGDYIAFGNNARYLKGVVGSGNRNFNIQFNLTAIRYGKNFDVPMIAAYELRGSKFDAEKIY 137
gi 489763932  84 PMHDYLESYDNVKRCAGIIGSGNLTLGKMYVITAKTYAKEYGLPLLDAFESRGTTRDIERIY 145
gi 489760995  82 ALGEYIAYNDNAKQCVGVVGSGNKNFNEQYCLTARKYARDFDAPFLADYELRGTSQDIERIY 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap