Conserved Protein Domain Family
FabA

?
pfam07977: FabA 
Click on image for an interactive view with Cn3D
FabA-like domain
This enzyme domain has a HotDog fold.
Statistics
?
PSSM-Id: 311780
View PSSM: pfam07977
Aligned: 31 rows
Threshold Bit Score: 117.752
Threshold Setting Gi: 81657799
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4B0C_C         28 LPAPN-MLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGN-PGRGRA 105
gi 81552694  2087 LPGRM-LLMLDRVTGSWPEGGTAGLGRLRSEKDVHPDAWFFRAHFFQDPVQPGSLGVEAMCQLLQYHLIEGGAaDGIAHP 2165
gi 226700241   29 LPLPP-MLMVHRITEISETGGAFDKGFIRAEYDVSPDDWYFPCHFQGNPIMPGCLGLDGMWQLTGFFLGWLGE-EGRGMA 106
gi 21362558    28 LPYPP-MLMFDRITEISETGGAFDKGFIRAEFDIKPDLWFFACHFIGNPIMPGCLGLDALWQLTGFYLGWLGE-PGKGMA 105
gi 81628245    21 lPAPP-LLMVDRVLSVEHTGSR---GKIIAETDIHLDDWFFQCHFRHDPVKPGCLGVDAIWQLLGLYISLRGG-VGSGRA 95
gi 81772183  1455 LSEKY-LDFLDEMLIIE-GGGNYQKGYIYARKSITPQDWYFPFHFYQDPVMPGALGVESIIQAMQAYALQLDLgKSFRNP 1532
gi 81697435  1861 LAGGR-LNFIDKVDITS-DGGKAGLGYLYAERTIDPSDWFFQFHFHQDPVMPGSLGVEAIIELMQTYALNKDLgAGFRSP 1938
gi 81552694  1674 LLDGErLRLLDEVTVFDPVGGPWGRGYLRAETAVSPDDWFFTGHFKNDPCMPGTLMLQGGLQAMAFYLTASGHtVDRDGW 1753
gi 81737251    35 LPAPP-MLMMDRISEISLDGGEFGKGHIVGELDIVPGHWFFDCHFRGDPLMPSSLGLDAMWQMIGYWLGWSGS-PGKGRA 112
gi 14251199   209 LPPGHrFRLLHQASLVR-EGGKFGLGYVKGERTIDAGEWYFTNHFHRDPVMPGSLGLEAILQAMQLFAIRTGLdAGIANP 287
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
4B0C_C        106 L-------GSGEVKFFGQVLPTAKKVTYNIHIKRT---INRSLVLAIADGTVSVDGREIYSA 157
gi 81552694  2166 RfepvlpgRETVWTYRGQITPANRLIRVDMDIVETg--TDARGPYAVADATLWGDDTCIYRV 2225
gi 226700241  107 L-------STGEVKFKGMVRPNTKLLQYGIDFKRV---MRGRLVLGTADGWLKADGETIYQA 158
gi 21362558   106 L-------STGEVKFKGMVTPSVKKVEYGVDFKRV---MRGRLVLGIADGWMKADGEPIYAA 157
gi 81628245    96 L-------GAKEVDFFGQIRPHNKVVRYEVSIRRYshlEQQGVSMVLGDGSVFVDGEQVYQI 150
gi 81772183  1533 Rfgq-ainHEITWKYRGQITPENHLMSLEVHISKIe--VESERITIIADASLWKEDLRIYEI 1591
gi 81697435  1939 Kfgq--iqsEVKWKYRGQINPLNKQMSLDVHITAIk--DEDGKRIIVGDANLSKDGLRIYEV 1996
gi 81552694  1754 Rfep-vdtQPSRTKCRGQATPESRRIVYELFVRGV---SAGPVPTLHADVLGSVDGRKAFLG 1811
gi 81737251   113 I-------GVGEVECTGEITPTVQRVRYEVAMRMV---RRGKLVLGIADGRVLADGACVFTA 164
gi 14251199   288 Rfgi-avgVPVNWRYRGQLLRTDKRMGLEVHIKEIr--REGEGLVVIADTDLFNDRLRIYEA 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap