Conserved Protein Domain Family
Intimin_C

?
pfam07979: Intimin_C 
Click on image for an interactive view with Cn3D
Intimin C-type lectin domain
This domain is found at the C-terminus of intimin. Its structure has been solved and shown to have a C-lectin type of structure. Intimin is a bacterial adhesion molecule involved in intimate attachment of enteropathogenic and enterohemorrhagic Escherichia coli to mammalian host cells. Intimin targets the translocated intimin receptor (Tir), which is exported by the bacteria and integrated into the host cell plasma membrane.
Statistics
?
PSSM-Id: 311782
View PSSM: pfam07979
Aligned: 14 rows
Threshold Bit Score: 104.803
Threshold Setting Gi: 124714
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1F02_I      182 PNSL-IVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKsSQTIISWVQQTAQDAKSGVASTYDL 260
gi 75399778 838 PKKI-VSVNSDSRVNYNSASSICGKINGSLPSSIAELETLYNKWGAANNYQHYT-QASITAWTLQTSDDVKKGVTSTYDL 915
gi 75399782 838 PQEI-VSLDKNGKVTYDEANSICLGNSAHLSASVDTLKKVYSQWGPASKYEHYT-QRTINAWIQQTDKDKREGVATTYDI 915
gi 75408106 838 PQEI-VSLDNSVKVKYDEASGICSNNAAYLSVSVDSLKKLYSQWGPANKYSHYT-QGTINAWIQQTEQDKKDSVATTYDI 915
gi 75399781 842 PENI-ITVETQDKVLYNVAKTKCEMNSGRLPSSTSELKDVYNQWGPANSYDGYKgKNTITAWTQQTADDIPKGWTSTFDI 920
gi 75391262 838 PSSM-I-VSINERMTYNNAMSSCQSLSGRLPSSQKELADVFDTWGAANKYEHYKtRNAMISWIKQTDQDMRQGVASTYDL 915
gi 75403474 842 PEKI-ITVETQNKVIYSVAEATCSTNSGRLPSSTSELKDVYNKWGAANSYEGYKgKNTITAWTQQTAADKQSGWTSTFDI 920
gi 75399780 839 PNSL-IVPNMSKRVTYNDAVNTCKILGGRLPSSQDELKNVFNTWGAANKYEYYKsLLTISSWVQQTTVDMNSGVASTYDL 917
gi 75417614 835 PDNIiIAVDKINRMAYSEAESRCQAISSNLAQSKSVLENIYSKWGAANKYPYYSsSNSLTAWIKQSTSDSASGVSNTYDL 914
gi 75418971 839 PSYM-IKVDK--QAYYADAMSICKNL---LPSTQTVLSDIYDSWGAANKYSHYSsMNSITAWIKQTSSEQSSGVSSTYNL 912
                        90       100
                ....*....|....*....|....*...
1F02_I      261 VKQNPLNN------IKASESNAYATCVK 282
gi 75399778 916 VRKNPQLNk-----VNINDNNAYAVCVK 938
gi 75399782 916 VTNNMVQN------VSSKTPNAYAVCVK 937
gi 75408106 916 VTDNTVIN------VDSTVANAYAVCIK 937
gi 75399781 921 VTKNEIPNngikvkVNVDAANAFAVCVK 948
gi 75391262 916 VKKNPLTNk-----VDINKPNAYATCVK 938
gi 75403474 921 VTKNEIPNngsnskVNVNTANAFAVCVR 948
gi 75399780 918 VRQNPL-Ng-----VETNTTNAYATCVK 939
gi 75417614 915 VTTNSLTN------VKATDKNAFAVCVK 936
gi 75418971 913 IIQNPLPR------VNVNTPNVYAVCVE 934
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap