1JKF


Conserved Protein Domain Family
NAD_binding_5

?
pfam07994: NAD_binding_5 
Click on image for an interactive view with Cn3D
Myo-inositol-1-phosphate synthase
This is a family of myo-inositol-1-phosphate synthases. Inositol-1-phosphate catalyzes the conversion of glucose-6- phosphate to inositol-1-phosphate, which is then dephosphorylated to inositol. Inositol phosphates play an important role in signal transduction.
Statistics
?
PSSM-Id: 311794
View PSSM: pfam07994
Aligned: 90 rows
Threshold Bit Score: 378.052
Threshold Setting Gi: 503605205
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JKF_A        66 LGIMLIGLGGNNGSTLVASVLANKHNVEFQTkegvkqpnyFGSMTQCSTLKLGIDA-EGnDVYAPFNSLLPMVSPNDFVV 144
gi 81554413    3 TGIWLVGARGSVATTTVVGAAALRAGLVPAT----------GCVSALEAFDG-----------------VPLPGFDELVF 55
gi 116698233  19 LGVLIPGVGGAVSTTFIAGVELVRRGLAEPI----------GSLTQLGTIRLGKRF-E--HRAPKIKEFVPLTDPGQLVF 85
gi 524034344  13 LGVLCVGL-GAVSTTFIAGSLMCRKGMGLP----------GGSITQMAKIRVGRGD-KK-T-YKRVGEIVPLADLKDFEI 78
gi 503211257  12 LGILLPGM-GAVATTLIAGVLASRKGLSKPI----------GSLTQMGTIRLGKRT-DK--RNPLIKDFVSLANLDDVVF 77
gi 497636929  15 TGLWLFGARGSVATTAIAGLAALRAGVADAT----------GCVTELPGLRE-----------------APLPAWGDIVV 67
gi 503605205  26 TGLWLVGARGSVATTATLGLAALAHGDAAPT----------GCVTAQPAFDG-----------------VPLPAFADLVV 78
gi 523980407  13 LGILCVGL-GAVSSTFITGVLMIRKGMGKPI----------GSITQMAKIRVGRGDkA---EYKHVSEIVPMPTLDDIVF 78
gi 524757276  13 LGVMVVGL-GAVSTTFMTGVLMTRKGLAKPV----------GSMTQYDKIRVGKGAdK---KYLHYKDIVPIADLNDIEF 78
gi 491931981  12 LGVLVVGVGGAVATTMIVGTLASRKGLAKPI----------GSITQLATMRMENNEeK------LIKDVVPLTDLNDIVF 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JKF_A       145 SGWDINNADLYEAMQR---SQVLEYDLQQRLKAKMSLVk-PLPSIYYPDFIAANQDERANNCINLDekgnvttrGKWTHL 220
gi 81554413   56 GGHDVVGTGLVKRAEQlaeAGVVPRGLPGVLTAELDAAdaEI---------RPAPPGTEEGGDGTP--------DQASAA 118
gi 116698233  86 GGWDLYEANGFEAAMY---ARVLSRDHLESIKDYLTGIv-PMKAVFDRRFVRNLDGTHIK---KGN--------SLRKHV 150
gi 524034344  79 GAWDIFTDNAYQSAMH---AEVLKPCHIEPVRDELERIv-PMKAAFDPEYVSRLHGENIKQA---S--------TRWELV 143
gi 503211257  78 GGWDLFTDNAYETANK---AGVLEKSDIEPLKDELIKIk-PMTAVYDHKYLVNLTP---NNIKEGP--------TKMDLA 142
gi 497636929  68 GGHDISDAPLHKSAEQlaeAGVLPTRVLGAVAPQLSDVesELRTGYDP-------------MSCGG--------SQAAAV 126
gi 503605205  79 GGHDVSPCPMVKRAEAlveAGMIAPRFLAAARPALESAdaEV---------RTGYDPREHQG------------SQQQAA 137
gi 523980407  79 GAWDILPDNAFESAMH---AEVLKDRDIYPVKEELEKIv-PMRGIYDQDYVKAIDGTWTKDTTL----------TRWQLM 144
gi 524757276  79 AAWDVYPANAYESAIN---AEVLKEKDIEPVADELKAIk-PMRAAFDHNYAKRLDGENYMKGA-----------TRWEMV 143
gi 491931981  76 GGWDIFPDNAYEAAMY---AEVLKEKDLNGVKDELEAIk-PMPAAFDHNWAKRLNGTHIKKAA-----------TRWEMV 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JKF_A       221 QRIRRDIQNFKEENALDKVIVLWTANTERYVEVSPGVNDTMENLLQSIKNDHEE-IAPSTIFAAASILEGVPYINGSPQN 299
gi 81554413  119 GAIVADLTGFRERLGLDRVVVVNVSSTQPPAVPHPA-HASAAALREALAR-GERpLPVSSLYAYAALRAGCAFVDFTPST 196
gi 116698233 151 EALKEDIGQFKAANGLERCIMIWCGSTEIHLKQ-EAIHQSIDALQRAIDANDSR-IPPSMLYAVAALECGVPFINGAPNL 228
gi 524034344 144 EQLRDDIRTFKKAHGCERIVVIWAASTEKYIPYNEQVHKNLSDLEEAMRADDRAnISPSMCYAYAAIAEGAPFVMGAPNL 223
gi 503211257 143 QQLMADIENFKKENNCSRIVVLWCASTEVYSAQTD-VHATVESLEEGLRNNDPN-ISPSMIYAYAAVKLGYPYINGAPNL 220
gi 497636929 127 RQLSSDIVSFRRRNRLRRVVAINVASTEAPAPDSPEQHD-LAALEERLDDERPR-LPAGVVNTCAALSAGCPYVEFTPSP 204
gi 503605205 138 ERLAADVVAFRERHRLARVVVVDLASTEPPVEPLPE-HDDVDALRAALADPARTvLPPSSVTAYAAVLAGAPYAAFTPSA 216
gi 523980407 145 EQAREDIRNFKEKNGCSRIVVIWAASTEIYIPRDKNVHDDLTAFEAAMKADDRQhISPSMCYAYAAMSEGAPFIMGAPNT 224
gi 524757276 144 ENIRKDIRDFKAAKNLDRIVVLWAASTEVYVPVDEKVHYTLAALEAAMKADDKEhVAPSMCYAYAALKEGAPFIMGAPNT 223
gi 491931981 141 EQLRQDIRDFKAANNCERIVVLWAASTEIYIPLSDE-HMSLAALEKAMKDNNTEvISPSMCYAYAAIAEGAPFVMGAPNL 219
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JKF_A       300 TF-VPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRSKEISKSSVID 378
gi 81554413  197 GArLPALDELAREQGLPYAGSDGKTGETLVKSVLAPMFARRALRVRSWSGTNLLGGGDGATLADPERVVSKNASKGLVLE 276
gi 116698233 229 TLdIPAMLELAEQANVPIAGKDFKTGQTLMKTILAPGLKSRMLGLEGWYSTNILGNRDGLVLDDKDSFKTKEESKLSVLE 308
gi 524034344 224 CIdIPAMWEFAEKQNVPLAGKDFKTGQTLMKTVLAPMLHTRCLGLSGWFSTNILGNRDGEVLDAPENFKTKEVSKLSVID 303
gi 503211257 221 SCdVPAMVELSHRTNTPIMGKDFKSGQTLMKTILAPGLRARLIGLDGWFSTNILGNRDGEVLDDPGSFKSKEVSKSGVLH 300
gi 497636929 205 GIgWASLRQLAERLGLPFAGCDGKTGETLLRSVLAPMFAERGLSVLSWSGTNLLGGGDGATLADPVTAAGKLESKSRGLA 284
gi 503605205 217 GMaIPALTRLAAEAGVPVAGQDGKTGQTWLRTVLAPAFAARGLRVLSWAGTNLLGGGDGATLADPENVRSKLATKSRGLR 296
gi 523980407 225 CLdIPAMWQYAEKTGTPIAGKDFKTGQTMMKTVLSTAFRTRMLGVSGWFSTNILGNRDGLVLDVPENFKTKEVSKLGVID 304
gi 524757276 224 TVdIPAMWELAEQTKMPIAGKDFKTGQTLVKSGFAPIIGTRCLGLNGWFSTNILGNRDGLVLDEPANFRTKEVSKLSTLE 303
gi 491931981 220 CVdTPAMWEFSKQKNVPIAGKDFKSGQTLMKTVLAPMFKTRMLGVNGWFSTNILGNRDGEVLDDPDNFKTKEVSKLSVID 299
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JKF_A       379 DIIASN--DI--LYndKLGkkVDHCIVIKYMKPVGDSKVAMDEYYSELMLG--GHNRISIHNVCEDSLLATPLIIDLLVM 452
gi 81554413  277 AELGHA--VE--GG-----------VHIHHVPDLGEWKTAWDHVTFEGFLG--ARMTLQFTWQGCDSSLAAPLVLDLARF 339
gi 116698233 309 YILQPH--LYptLY--KN---YYHKVTINYYPPRGDNKEGWDCIDIFGWLG--YPMQIKVDFLCRDSILAAPLILDLVLL 379
gi 524034344 304 TILDKN--ELpeLY--SD---IYHKVRINYYPPRGDNKEGWDNLDIFGWMGpdYGMQIKIDFLCRDSILAAPLMLDLVLC 376
gi 503211257 301 DILEPElfPE--LY--GNT---YHKIRIEYYPPRGDFKESWDCLDIFGWMN--YKMQIKINFSCRDSILAAPLALDLALF 371
gi 497636929 285 ELLGPG--VS--AP-----------LHIDHVADLGQTKIAWDNVHARGFLG--APVTLQLTWTGYDSALAAPLVLDLTRL 347
gi 503605205 297 DLTGSD---T--TP-----------LHIDNVPDLGDIKVAWDHVHVEGFLG--SRLTLQTTWSAYDSMLAAPLVLDLARL 358
gi 523980407 305 TILKKD--EY--PDlyGD---IFHKVRINYYPPRNDDKEGWDNIDIFGWMG--YPMQIKVDFLCKDSILAAPLLLDLALL 375
gi 524757276 304 TILEAD--KQ--PDlySN---YYHKVRINYYPPRNDNKEGWDNIDIFGWMG--YPMQIKINFLCRDSILAAPLCLDLVLL 374
gi 491931981 300 TIFEPE--KY--PDlyGD---VYHKVRINYYPPRKDNKEAWDNIDIFGWMG--YPMEIKVNFLCRDSILAAPIALDLVLF 370
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
1JKF_A       453 TEFCTRVSYKkvdpvkedagkfenfYPVLTFLSYWLKAPLTR--PGFHPVNGLNKQRTALENFLR 515
gi 81554413  340 MALAHRAGVA----------------GPVPELGFFFKDPVGS------AEHDLAAQYASLAAWAR 382
gi 116698233 380 TDLAQRVGM----------------NGIQEWLSFYFKSPMHK--ESLYPEHDIFIQSMKLKNTLR 426
gi 524034344 377 ADLAARAGWT----------------GIQTWMSFYLKSPMHDyvKGIEPVHDLFQQFAMFKNAIR 425
gi 503211257 372 IDLAKRADMR----------------GVQEWLSFYCKSPQTA--QGLPAQNDVFKQLEKLENTLR 418
gi 497636929 348 VAMAHHAGQR----------------GALGALGCFFKDPLGD--SG----HRFDHQVRRLREWVR 390
gi 503605205 359 LALAHAAGVA----------------GPVPELGFFFKDPWAS------DTHDAAAQAAELQAWAR 401
gi 523980407 376 GDLALRAGKS----------------GIQTWLSFYLKSPMHD--DEHEPVHDLFQQYTMLKNAIR 422
gi 524757276 375 SDLAARAGRF----------------GIQRFLSFFLKSPMHDytQGEEAVNHLFQQYVMLKNAIR 423
gi 491931981 371 SDLAMRAGMC----------------GIQTWLSFFCKSPMHD--FEHQPEHDLFTQWRMVKQTLR 417
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap