Conserved Protein Domain Family
T4SS

?
pfam07996: T4SS 
Type IV secretion system proteins
Members of this family are components of the type IV secretion system. They mediate intracellular transfer of macromolecules via a mechanism ancestrally related to that of bacterial conjugation machineries.
Statistics
?
PSSM-Id: 336895
View PSSM: pfam07996
Aligned: 42 rows
Threshold Bit Score: 106.655
Threshold Setting Gi: 500123403
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123062795   25 GIPV-FDAQN-------VAQAIA------------------TVAQLEQQVRQEIQIYqstVGTRGF---GALMSNPV--- 72
gi 81645527    22 GIPV-FDAVQ-------NVESINqwvqkl-------qqwedTVTHYKSELNAYKQQL---ATATGVrniQGFLSDARs-- 81
gi 499204398   38 GIPV-VDAAAagqrqmsMLQTVQqwakea-------kqwtdTVSHYKNELKAYADQLa---sQTGIrdvQAFIGEAH--- 103
gi 506354044   26 GILV-FDATS-------KMENARqwakea-------kqwmeTVEHYKAQMNVYKDQL---ATSTGLrdiQGLLEQGKsl- 86
gi 640528473   46 GIPV-VDAAA-------NAQMTNqnlkqivewakeakrwvdTTTHYSAQLNAYAKQL---ATQSGVrdvTSFLEEAKdvy 114
gi 501337234   25 GIPV-VDATA-------IADRLKqdvktaaqwtkeaaqwtkELKAYQDELL----------SKTGIrdvQGLIQDAKe-- 84
gi 156534789   10 GIPIlVDADP-------MRETewlkea---------qrwmeTAKHYQSQIQAYKDQL---ATATGArdiADFVNQAKs-- 68
gi 1062992999  22 GIPVaVDADP-------MRDVqwaqel---------krwmeTARHYQSQIQAYKDQL---ATATGVrdiADFVDQAKg-- 80
gi 505735123   22 GIPV-FDAVQ-------NTESMNqwiqkl-------qqwqeTVTHYRSELDAYKQQL---ATATGVrdvQAFLREAKs-- 81
gi 503083722   22 GIPV-FDAVS-------NTESINqwmqkl-------kqwqeTVTHYKDELDAYKQQL---ATATGIrdiQGFLREAKs-- 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123062795   73 -VA----KslpsnwqSVYTAIQNGG----------YSGL-------TGSAQALRSASQIYNCEdqtg-------idqQVC 123
gi 81645527    82 -LK----T-------DIDNLRKNGIslddl-ltnhNGSY-------SSELQHLYSKYKSFSVCsteqegi-ksqtltDSC 140
gi 499204398  104 -SLygeiNglkseftPVIDLVSGG-----------KNAL-------SANAKSLFEKYNLFDRCknlr------qgeiTSC 158
gi 506354044   87 -------------qsEIKTLQNQGIs---------LNDLltsdnppRGALDSLYHKYKSFDVCgdstsssklpasylNAC 144
gi 640528473  115 dEA----KkvgttlgELKDFKNSG-----------KDSI-------SSKVKKLMDKFFEYDYCkdivdv---dkttqNIC 169
gi 501337234   85 -IA----G-------DLTDIYNEGTafydnyienpTGIL-------SEKAQALLDKYKVGEMCvkqgf----sgdliKGC 141
gi 156534789   69 -LS----A-------DLERLRKPGQalnd---llmSGGS-------SGQFDELYEKYKIFNTCntgqs-----gsyaDVC 121
gi 1062992999  81 -LK----A-------DLEKLRKPGQalnd---lllSGGS-------SGQFDALYEKYKIFDTCntaqs-----gsyaNVC 133
gi 505735123   82 -LK----T-------DIDNLRQNGIslddl-lsnqSGSY-------SSELNSLYNKYKSFDTCnpssa----sprylDSC 137
gi 503083722   82 -LK----G-------DIDALRKNGIslddl-ltnpDGSY-------SSALQGLYKKYQSFDSCnpsrs----slryqDSC 137
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123062795  124 QRALSKPFQDKAFGQQAYQTELQELNQIQSLAQQIDVTQDPKGVAELQARIQAETTTVNNEMTRLQLFRMLSEAEDKLVA 203
gi 81645527   141 QQMVLNQAMAIENTAEVENKITGTLSDISALSDRISNAQDSKESQDLANAIAAKSVQLNALTSQWEMSVKQAEQRTTLLE 220
gi 499204398  159 EANIVSTVESMSFLDSFESNVNSKLKTIDKLAKRMTKSQDVKESQDLKNAMDVQLAALQSQKVQLDLFNARQTEYRRLMN 238
gi 506354044  145 KQETANKGYMIEQTAEVQKKINVALKDIGHLSHRIANAKDSKESQDLANAIQARSVQLNSLTSAWEMNIKAAEQRDKLLS 224
gi 640528473  170 YQKRSANIEDIVFYKERSDTIGMYSKNINKLAKKLQKSKDIKESSDLNNAIQAQVALMQAEKIQIDLYAKQRENSKNIME 249
gi 501337234  142 EARVLSDLASVAYGENLQENINKDNKKMKGLIDQVKSATDPKSTADAANAIALEQLKFEKMKFQYEMYRDKQAQLSKyke 221
gi 156534789  122 KQEVINKAVQLEQTNDIQREVDNTLGEIDRLSNRIALSKDSKESQDLANSIQLKSVMLNTLTNQWEMSVKAAEKREKVLQ 201
gi 1062992999 134 KQQVINKAIQLEQTDEVQNQVSQTLGEINSLSNRVALAKDSKESQDLANSIQLKSVMLNTLTTQWEMSVKAAEKRENALE 213
gi 505735123  138 KQMILNQAVAIENTSEIENKITGTLGDISDLSDRIANAQDSKESQDLANAIAAKSVQLNALTSQWEMSVKQTEQRTVLLE 217
gi 503083722  138 KQLLLNQALAIENTREVQDRITSTLNDIADLSDRITNAKDSKESQDLANAVAAKSVQLNALTSQWEMSVRQTEQRATLLE 217

                  ...
gi 123062795  204 EQQ 206
gi 81645527   221 QQR 223
gi 499204398  239 EQQ 241
gi 506354044  225 AKR 227
gi 640528473  250 DRE 252
gi 501337234  222 emv 224
gi 156534789  202 EQR 204
gi 1062992999 214 AER 216
gi 505735123  218 QQK 220
gi 503083722  218 QQR 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap