Conserved Protein Domain Family
DUF1699

?
pfam08004: DUF1699 
Protein of unknown function (DUF1699)
This family contains many archaeal proteins which have very conserved sequences.
Statistics
?
PSSM-Id: 311800
View PSSM: pfam08004
Aligned: 38 rows
Threshold Bit Score: 154.272
Threshold Setting Gi: 505126842
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121689172   1 MKIRVVSSKEEIKTLSENEEIVHLAFRPSNTDIFSLVVKCPSVKALHIPSSYKKTISKSAKMYLEMQGINLLEGDVWGHR 80
gi 74527889    6 IRIRVVTNRDEILSLEHEEKAVHLAFRPSDRDLFSLVKTCPGIEILQLPASSYEGLSKFIKMFLTSSGIHLVKGDVSGHW 85
gi 121694800   1 MRIRVVSSKSEIAQLNPNERMVHLAFRASNVDFLNLMQRCPRLRVIQVPPSYKKTMSNAIQVFLEMQGIELLEGDVWGHR 80
gi 504400709   1 MRIRVVSSKDEIAELNPNERIVHLAFRPSNVDFLDLMRSCPRLRAVQVPPSYHKTMSKAIKLFLEMQGIDLLEGDVWGHR 80
gi 505126836   1 MRIKVIKSLEEINTL-KGASIVHISFRPSRDDILAIHKACPKLKAIQLPPSHFNTLSISASYYLKIVGITLIKGNIIRIV 79
gi 504400671   2 IKIRIVSSKDEIKDLTRGDHTVHLAYRASSTDMFRLLQYSPRLRAVQVPPSYYRNMPTTARAFLETQGVEIIEGDVWGHR 81
gi 504400707   1 MKLRVVSSKKEIPELNPNERIVHLAFRASNVDFLTLMKRCPRLRAIQVPPSYRRTISQAIQVFLDMQGISLLEGDVWGHR 80
gi 504400708   1 MKIRVVSSKDEITKLGPNERNVHLAFRPSNVDFLELIRVCPRLRTIQVPPSYHKTLSRAIRLFLEMQGITLLEGDVWGHR 80
gi 504399595   1 MKIRVVSQRSEIADLSPNERMVHIAFRPSNVDLLDLIKACPRLRAIQVPPSYNKTLSKAIRLFLQMQGIDLLEGDVWGHR 80
gi 941506381   1 MRIRVVSSKDEISHLNPNERIVHLAFRPSNVDFLDLMRSCPRLRAVQVPPSYHKTMSKAIKLFLEMQGIDLLEGDVWGHR 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 121689172  81 KDINEYSEVSQGVYDRIKEYRDSGISEEEINEKMVRETRLSPDFIEFLMK 130
gi 74527889   86 HDLNNYFVIPSYVLEKIKELEVQGRTEKEIIEEITNLRKISPDMVLHLLH 135
gi 121694800  81 KDLDEYFTVSDTTIEEIRSMINKGVSFEQMAEELQKKARIGPDLIKYIVK 130
gi 504400709  81 KDIDEYYVVDEEAIEEIGNLIKQGESIEDASAAIQRKTRLAPDLIRYIAK 130
gi 505126836  80 ENKNSEYTISKLIINKIRTKIIDGENDESIIQSFSEYENPSTELLQFLIH 129
gi 504400671  82 KDIDEYFVIDDEMIERITRLQSDGLKVEEISSRISWESKLSPAMVNYIIK 131
gi 504400707  81 KDIDEYYVVSEETIGEIEAMISRGATAEEAAEEITKRTRLAPDLIRYIAr 130
gi 504400708  81 KDIDEYYIVDEEPIEEIGSLIREGESLEEAAAAIQRKTKLSADLIKYIAr 130
gi 504399595  81 KDIDEYYMVDEGAIERIGDLISSGESIDDAVAQVTMTTRLSPDMIKYIAK 130
gi 941506381  81 KDIDEYYVVDEGAIEEIGTMIKEGESIEEATAAIQRKTRLAPDLIKYIAK 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap