Conserved Protein Domain Family
CDP-OH_P_tran_2

?
pfam08009: CDP-OH_P_tran_2 
CDP-alcohol phosphatidyltransferase 2
This domain is found on CDP-alcohol phosphatidyltransferases. These enzymes catalyze the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond.
Statistics
?
PSSM-Id: 311803
View PSSM: pfam08009
Aligned: 45 rows
Threshold Bit Score: 28.9825
Threshold Setting Gi: 502805656
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 81737704  208 ELVLPAFVAVIVFIAILIAYPWHVLSIGTVLYLLALP 244
gi 81625815  177 EYLSLAMILVAIVIINLIIYPWYSLPLIAVIYILSIP 213
gi 123492191 200 YLESALIFLFVTIAVALILKPWLTISVLALCYICSMP 236
gi 123493082 204 NLSYIFILLFGIFIVFAITKPWITFPVVGMMYILSIP 240
gi 123495290 193 RLSYLFITLLAVLMVLAITNPWITFPIMGFTYLMSIP 229
gi 524158851 208 YMFMPMMLIVALFASFIITQPWFTLGIMTVLYAVSIP 244
gi 739492797 211 RWFYMLVTILAVLMVLAITNPWVILPLMGVLYFVSIP 247
gi 740773723 200 YLESILMFFFAVTAVAFILKPWITIPILSLCYVLSIP 236
gi 503716922 198 EYVVPLLVLTGVMMAGILIEPWFILPLMGVGYILSIP 234
gi 154155519 240 dMVLPILLLVGLSAAVILSYPWIAFTALCALYLVSIP 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap