Conserved Protein Domain Family
Tagatose_6_P_K

?
pfam08013: Tagatose_6_P_K 
Click on image for an interactive view with Cn3D
Tagatose 6 phosphate kinase
Proteins in this family are tagatose 6 phosphate kinases.
Statistics
?
PSSM-Id: 311806
View PSSM: pfam08013
Aligned: 67 rows
Threshold Bit Score: 552.5
Threshold Setting Gi: 500132969
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3TXV_A         8 LIDIARWSERPGPRGIPSICSAHPLVIEAAXLRAHREKAPVLIEATCNQVNQDGGYTGXTPEDFTRFVGAIADRIEFPRE 87
gi 123510074   5 LTRLAAARREGRPFGITSVCSAHSLVLRAAIRRAVHDGGPVLIEATCNQVNHLGGYTGMRPEDFIRFAERIGAEEGLDRA 84
gi 504050180   5 LLEVITANRAGARAALPSICSAQPDVILASALLAAEKNATLLLEATSNQVNQDGGYTGMKPADFVSYVKGICTSAGLPED 84
gi 500132969   4 LRDINQRNRSAGVACTPSVCSAHPQVLLASLLLAQSRQRPLLVEATSNQVNQFGGYTGMQAADFIAHVQRIGQAHGIDRS 83
gi 505314522   5 LRDIIKRNRAGQAVAIPSVCSAQADVILASLLRAQTLDRAIVIEATSNQVNQFGGYTGMRPSDFMAFVRGIAKAADVDLD 84
gi 489715435   6 LMKLVQDRRAGKCSGIVSVCSAHPLVIEAAFRQGLMENTAVLIEATCNQVNHRGGYTGMTPEKFRIFVEKIARQVSFPVE 85
gi 494976432   8 LANMPRSRGSDLPSGITSVCSAHPLVIEAALSHAKGRNADVLIEATCNQVNQDGGYTGMTPADFRAFVEKIAAAVGFPLD 87
gi 500733685   7 LSALPARYASGVRGGITSICSAHPLVIEAALLEGIATSTDVLIEATCNQVNQDGGYTGMTPADFRRFVEDIAARVGFDTK 86
gi 502084123   6 IATIARDRIAGDRSGITSVCTAHPIVIEAALLQGKAEGTEVLIEATCNQVNQEGGYTGMTPAHFRRFVSGIAERVGFDPR 85
gi 499275419   5 LENLAAARRAGKPAGITSVCSAHPVVLRAAIRRAAASQTAVLIEATCNQVNHLGGYTGMTPRDFVAFVNSIAAEEGLPAE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3TXV_A        88 KILLGGDHLGPNPWKHLPADEAXAKAEAXITAYAKAGFTKLHLDTSXGCAGEPTALPDATTAARAARLAAVAEDAVGGRG 167
gi 123510074  85 QMIFGGDHLGPNPWRKKGPEAALEQAELMVEAYVRAGFGKIHLDASMGCAGDPAVLDDRTIAERAAGLAEISERTAKAIG 164
gi 504050180  85 ALILGGDHLGPQAWRSMPAEKAMAKAKELMKAYVQAGFTKIHLDCSEGCAGEEAQVGDELSASRAAELAAVCEEFAPD-- 162
gi 500132969  84 LVLFGGDHLGPQVWRDQDAHSAMAHASALVASYVQAGFGKIHLDCSEGCAGEAAQVGDALSAQRAAQLARVCEQAARN-- 161
gi 505314522  85 RIQFGGDHLGPQVWRDESSDSAMAKAHELVTDYVRAGFTKIHLDCSEGCVSELAQLDDEITSARSAELARTCVNLADD-- 162
gi 489715435  86 RIIMGGDHLGPNPWKNLSADAAMTEARAMVEAYAKAGFTKLHLDTSMGCSGEPIALSDSLTASRAATLAKVAEDAVRERG 165
gi 494976432  88 RLILGGDHLGPNPWKHLPSSEAMRKAGAMIDAFAAAGFTKLHLDTSMACADDPTALPDETIASRAAELAAISEARIRQSK 167
gi 500733685  87 RLILGGDHLGPNPWKHLPAEEALAKSDVMIDAFVRAGFTKIHLDTSMGCAGEPVALPDAVTAERAARLAKVSEAAAHEAG 166
gi 502084123  86 RLILGGDHLGPNPWKHLPAQEAMVRAEAMVDAYVRAGFTKIHLDTSMGCAGESLALANETTAERAARLASVAEAASGNT- 164
gi 499275419  85 LLIFGGDHLGPNPWRREKAEDALTKAAAMVDAYVTAGFRKIHLDASMGCAGEPAALDDVTIAHRAAKLTAVAEKAATEAG 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3TXV_A       168 GVLPVYIIGTEVPIPGGALEELD--T--LEV--TAPEAAIETVRVHRAAFEEAGAAGAFSRVVGAVVQPGVEFGNENVIA 241
gi 123510074 165 APPPLYILGTEVPAPGGADHALE--E--LRP--TAPEAARATIAIHREIFSRAGLEEAFSRVIAFVVQPGVEFGSENVIG 238
gi 504050180 163 PTRLNYIVGTEVPPPGGAREEGEahG--IEP--TPPARASRTLQMHFEKFDVLGLHAAKERICGLVVQPGVEFSPFHIDH 238
gi 500132969 162 PQALSYVVGTEVPPPGGARAEDG--A--MRVppTSAQSARLTIAAHQQAFAQQGLHEAWGRVTGLVVQPGLEFGPDHVQH 237
gi 505314522 163 ---LMFIVGTEVPPPGGARTD-E--CgdIAA--TSPDAASATLALHMDKF-----GEIAALIGGLVVQPGVEFSPVQIHH 229
gi 489715435 166 TEAPVYVIGTEVPIPGGALEAID--S--LEV--TKPNAAIATLDIHRRAFEAAGLSDAFIRVIAAVVQPGVEFGNENVIV 239
gi 494976432 168 TQAPSYIIGTEVPVPGGAFEALD--H--LHV--TTPGDARATVELHRTAFSRLGLNEAFERSIGIVVQPGVEFGNADVVA 241
gi 500733685 167 YDLPVYIIGTEVPIPGGAMEEIE--E--LEL--TKPGAAVETVAIHRKAFAALGLEDAFARAIGVVVQPGVEFGNENVVF 240
gi 502084123 165 GSSPFYVIGTEVPVPGGALESID--N--LEV--TGPEAALETVDVHRKSFAAAGVSHAFERAVGVVVQPGVEFGNANVIT 238
gi 499275419 165 LPKPLYILGTEVPVPGGADHVLE--T--VAP--TEPQAARNTIDLHREIFAQHGLSDAFERVIAFVVQPGVEFGSDNVVA 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3TXV_A       242 YDRARAEKLSATLGQLH-GXVFEAHSTDYQTPDALRELVADGFAILKVGPGLTFALREALYGLDQIAAFLFPAARERT-L 319
gi 123510074 239 YRPELASELTALLDEEP-QFVFEAHSTDYQTRDALTRLVQDGFPILKVGPGLTFALREAAYALDMIASEMVAGYGDRP-L 316
gi 504050180 239 LPADDGKALRAALDPFT-NVVFEAHSTDYQLDNAFPRLANMGFAILKVGPALTFAYRQAIYALDQMLDWLDEDKRTAPkI 317
gi 500132969 238 FDLQAPDSLSEVLAPHP-QLAFEAHSTDYQKPPVFAALARRHFTVLKVGPALTFAYRQAVYALDALATWLAPQSPRAA-L 315
gi 505314522 230 LPMAKDPKLIQSIADWP-SVCLEAHSTDYQHPQVFPRLAQLGFAFQKVGPALTLAYRQALYSLDIVRSLSSRGE--RH-L 305
gi 489715435 240 YDREKAQALSASLDSMPiPILFEAHSTDYQPEKALAALVQDGFAILKVGPGLTFALREALYGLDHIAIELQLETDSTG-L 318
gi 494976432 242 YVREAARDLVATLDEMP-QFVFEAHSTDYQSGEALRDLVSDGFAILKVGPWLTFALREALYGLSAIAEILVPDAISEA-V 319
gi 500733685 241 YNSEKATALSGVLSEMA-QFVFEAHSTDYQPVEALSDLVDDGFTILKVGPGLTFALREALYGLDQIAAFLDKLPEEET-L 318
gi 502084123 239 YDREKAADLSAVLSKMP-QFVFEAHSTDYQPAEALRALVEDGFAILKVGPWLTFALRQALYGLDQIAQVLDAKFSEHS-L 316
gi 499275419 239 YDPQAAQSLSAVLDGEP-RLVFEAHSTDYQTEPALAALVRDGYPILKVGPGLTFAYREALYALDMIASEMVGTYGDRP-L 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3TXV_A       320 AEVTEAVXREEPANWAKYYHGSAEEQRLQRHFSYSDRIRYYWPHPKAAAAVDELXSLLDGVAIPE-TLISQFLAG---S- 394
gi 123510074 317 AAAMEALMLAAPGDWQAHYHGDETALRLQRHYSYSDRIRYYWKRPEAGKAFERLLGALRGKTIPG-TLLRQYLPQ---L- 391
gi 504050180 318 SKILETEMLSEPKYWRSHYQGSDHELRLLRHFSYADRIRYYWPQEKVQDALEALFAALQTHKIPE-TLLLQLFAS---Qt 393
gi 500132969 316 AQVLEQLMQAEPQHWRKHYSGDARALRLLRHFGYADRVRYYWGQPAAKSAVAQLMQLLAEQPEPLaPLLAQHFADpvlE- 394
gi 505314522 306 SAALETAMLDDPRYWQSHYQGDAEQLLQQRHFGLADRIRYYWPVPSVQAAVQQLVVDLPRQ-IPD-PILWQVFGQpvlD- 382
gi 489715435 319 RMCMEKLMLREPEYWQRYYHGSDQALRIQRHFSYSDRIRYYWTHPDAMAAVSRLFAVLEDVAIPE-TLISQYLAR---V- 393
gi 494976432 320 PAAMERIMLSSPEHWLKYYPGDAHEQYVQRHYSFSDRIRYYWAVPAAQKAVDELMAALQGVTIPR-PLISQHLGH---L- 394
gi 500733685 319 RGKMEALLLAEPKNWEKYYHGDAEELRLQRHFSYSDRIRYYWPHPVATAAVDALLNRLEGRKIPE-TLISQYLGT---L- 393
gi 502084123 317 CAAMERLMLREPANWQKYYHGDATELRIQRHFSYSDRIRYYWPHPEAQAAIKRLLSFLQGRTIPE-TLISQYLEG---L- 391
gi 499275419 317 ARTMEKLMLSAPGDWQGHYHGDDITLRLQRHYSYSDRIRYYWTRPEALAAVSTLHKALDGKTIPE-TLLRQYLGE---L- 391
                        410       420       430
                 ....*....|....*....|....*....|....
3TXV_A       395 --YARVRNgevapQAKPLALAAVDAVLQDYFAAC 426
gi 123510074 392 --SAAEVG-----DPETILIAAVDRVLADYQSAC 418
gi 504050180 394 veRARALQsygfgIEKALVLAEIQQALDPYFFer 427
gi 500132969 395 --GAQTLQsqgfaWPQALVLAQIQAALNPYFLAp 426
gi 505314522 383 --RAEDLAg---sQIERLVRAQIQIALDPYffdp 411
gi 489715435 394 --YPQVMSgqlvpAPRELVIASVQQVLAEYAVAV 425
gi 494976432 395 --ESLVADgsvapQARALLLASVTRVLDIYADAI 426
gi 500733685 394 --YPAVASgeieaTPHALMVEAVRNVVRTYGKAV 425
gi 502084123 392 --YPAVASgqvsaDAISLQLASVRRVLGIYARAC 423
gi 499275419 392 --PLAAVAg---kEPEEVLVAAVDQVLATYHAAT 420
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap