2FIQ,3TXV


Conserved Protein Domain Family
Tagatose_6_P_K

?
pfam08013: Tagatose_6_P_K 
Click on image for an interactive view with Cn3D
Tagatose 6 phosphate kinase
Proteins in this family are tagatose 6 phosphate kinases.
Statistics
?
PSSM-Id: 336901
View PSSM: pfam08013
Aligned: 68 rows
Threshold Bit Score: 549.037
Threshold Setting Gi: 500132969
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIQ_A         2 KTLIARHKAGEHIGICSVCSAHPLVIEAALAFDRNSTRKVLIEATSNQVNQFGGYTGXTPADFREFVFAIADKVGFARER 81
gi 81812087    7 IDIARWSERPGPRGIPSICSAHPLVIEAAMLRAHREKAPVLIEATCNQVNQDGGYTGMTPEDFTRFVGAIADRIEFPREK 86
gi 504050180   6 LEVITANRAGARAALPSICSAQPDVILASALLAAEKNATLLLEATSNQVNQDGGYTGMKPADFVSYVKGICTSAGLPEDA 85
gi 505314522   6 RDIIKRNRAGQAVAIPSVCSAQADVILASLLRAQTLDRAIVIEATSNQVNQFGGYTGMRPSDFMAFVRGIAKAADVDLDR 85
gi 500132969   5 RDINQRNRSAGVACTPSVCSAHPQVLLASLLLAQSRQRPLLVEATSNQVNQFGGYTGMQAADFIAHVQRIGQAHGIDRSL 84
gi 489715435   7 MKLVQDRRAGKCSGIVSVCSAHPLVIEAAFRQGLMENTAVLIEATCNQVNHRGGYTGMTPEKFRIFVEKIARQVSFPVER 86
gi 500075053   7 KSIAEWRDRPGPSGIPSICTAHPMAIEAAMRCTAPTPLPLLIEATCNQVNQDGGYTGMTPADFRRFVEEIAARTGFPLER 86
gi 494976432   9 ANMPRSRGSDLPSGITSVCSAHPLVIEAALSHAKGRNADVLIEATCNQVNQDGGYTGMTPADFRAFVEKIAAAVGFPLDR 88
gi 500733685   8 SALPARYASGVRGGITSICSAHPLVIEAALLEGIATSTDVLIEATCNQVNQDGGYTGMTPADFRRFVEDIAARVGFDTKR 87
gi 502084123   7 ATIARDRIAGDRSGITSVCTAHPIVIEAALLQGKAEGTEVLIEATCNQVNQEGGYTGMTPAHFRRFVSGIAERVGFDPRR 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIQ_A        82 IILGGDHLGPNCWQQENVDAAXEKSVELVKAYVRAGFSKIHLDASXSCAGDPIPLAPETVAERAAVLCFAAESVATDCQR 161
gi 81812087   87 ILLGGDHLGPNPWKHLPADEAMAKAEAMITAYAKAGFTKLHLDTSMGCAGEPTALPDATTAARAARLAAVAEDAVGGRGG 166
gi 504050180  86 LILGGDHLGPQAWRSMPAEKAMAKAKELMKAYVQAGFTKIHLDCSEGCAGEEAQVGDELSASRAAELAAVCEEFAPD--P 163
gi 505314522  86 IQFGGDHLGPQVWRDESSDSAMAKAHELVTDYVRAGFTKIHLDCSEGCVSELAQLDDEITSARSAELARTCVNLADD--- 162
gi 500132969  85 VLFGGDHLGPQVWRDQDAHSAMAHASALVASYVQAGFGKIHLDCSEGCAGEAAQVGDALSAQRAAQLARVCEQAARN--P 162
gi 489715435  87 IIMGGDHLGPNPWKNLSADAAMTEARAMVEAYAKAGFTKLHLDTSMGCSGEPIALSDSLTASRAATLAKVAEDAVRERGT 166
gi 500075053  87 LILGGDHLGPNPWKSLPADQAMAKAEVMIRAFAAAGFTKLHLDCSMGCAGEPVALDDAQTAARAARLAAAAEEARPQ-GG 165
gi 494976432  89 LILGGDHLGPNPWKHLPSSEAMRKAGAMIDAFAAAGFTKLHLDTSMACADDPTALPDETIASRAAELAAISEARIRQSKT 168
gi 500733685  88 LILGGDHLGPNPWKHLPAEEALAKSDVMIDAFVRAGFTKIHLDTSMGCAGEPVALPDAVTAERAARLAKVSEAAAHEAGY 167
gi 502084123  87 LILGGDHLGPNPWKHLPAQEAMVRAEAMVDAYVRAGFTKIHLDTSMGCAGESLALANETTAERAARLASVAEAASGNT-G 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIQ_A       162 EQLSYVIGTEVPVPGGEASAIQS--VHITHVEDAANTLRTHQKAFIARGLTEALTRVIAIVVQPGVEFDHSNIIHYQPQE 239
gi 81812087  167 VLPVYIIGTEVPIPGGALEELDT--LEVTAPEAAIETVRVHRAAFEEAGAAGAFSRVVGAVVQPGVEFGNENVIAYDRAR 244
gi 504050180 164 TRLNYIVGTEVPPPGGAREEGEAhgIEPTPPARASRTLQMHFEKFDVLGLHAAKERICGLVVQPGVEFSPFHIDHLPADD 243
gi 505314522 163 --LMFIVGTEVPPPGGARTD-ECgdIAATSPDAASATLALHMDKF-----GEIAALIGGLVVQPGVEFSPVQIHHLPMAK 234
gi 500132969 163 QALSYVVGTEVPPPGGARAEDGAmrVPPTSAQSARLTIAAHQQAFAQQGLHEAWGRVTGLVVQPGLEFGPDHVQHFDLQA 242
gi 489715435 167 EAPVYVIGTEVPIPGGALEAIDS--LEVTKPNAAIATLDIHRRAFEAAGLSDAFIRVIAAVVQPGVEFGNENVIVYDREK 244
gi 500075053 166 IAPVYVIGTEVPIPGGAMEEIEG--LELTSPGAALATFQVHCRAFADAGQQDAFTRVVGLVVQPGVEFGNHNVIDYDPAA 243
gi 494976432 169 QAPSYIIGTEVPVPGGAFEALDH--LHVTTPGDARATVELHRTAFSRLGLNEAFERSIGIVVQPGVEFGNADVVAYVREA 246
gi 500733685 168 DLPVYIIGTEVPIPGGAMEEIEE--LELTKPGAAVETVAIHRKAFAALGLEDAFARAIGVVVQPGVEFGNENVVFYNSEK 245
gi 502084123 166 SSPFYVIGTEVPVPGGALESIDN--LEVTGPEAALETVDVHRKSFAAAGVSHAFERAVGVVVQPGVEFGNANVITYDREK 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIQ_A       240 AQALAQWIENTr--XVYEAHSTDYQTRTAYWELVRDHFAILKVGPALTFALREAIFALAQIEQELIAPE-NRSGCLAVIE 316
gi 81812087  245 AEKLSATLGQLh-gMVFEAHSTDYQTPDALRELVADGFAILKVGPGLTFALREALYGLDQIAAFLFPAA-RERTLAEVTE 322
gi 504050180 244 GKALRAALDPFt-nVVFEAHSTDYQLDNAFPRLANMGFAILKVGPALTFAYRQAIYALDQMLDWLDEDKrTAPKISKILE 322
gi 505314522 235 DPKLIQSIADWp-sVCLEAHSTDYQHPQVFPRLAQLGFAFQKVGPALTLAYRQALYSLDIVRSLSSRGE---RHLSAALE 310
gi 500132969 243 PDSLSEVLAPHp-qLAFEAHSTDYQKPPVFAALARRHFTVLKVGPALTFAYRQAVYALDALATWLAPQS-PRAALAQVLE 320
gi 489715435 245 AQALSASLDSMpipILFEAHSTDYQPEKALAALVQDGFAILKVGPGLTFALREALYGLDHIAIELQLET-DSTGLRMCME 323
gi 500075053 244 ARDLSAVLAQMp-gVVFEAHSTDYQTRGALTALVRDGFAILKVGPGLTFVLREALYGLDAIAEELFPGR-RQRSLRQATE 321
gi 494976432 247 ARDLVATLDEMp-qFVFEAHSTDYQSGEALRDLVSDGFAILKVGPWLTFALREALYGLSAIAEILVPDA-ISEAVPAAME 324
gi 500733685 246 ATALSGVLSEMa-qFVFEAHSTDYQPVEALSDLVDDGFTILKVGPGLTFALREALYGLDQIAAFLDKLP-EEETLRGKME 323
gi 502084123 244 AADLSAVLSKMp-qFVFEAHSTDYQPAEALRALVEDGFAILKVGPWLTFALRQALYGLDQIAQVLDAKF-SEHSLCAAME 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIQ_A       317 EVXLDEPQYWKKYYRTGFNDSLLDIRYSLSDRIRYYWPHSRIKNSVETXXVNLQGVDIP-LGXISQYLPK---QFERIQS 392
gi 81812087  323 AVMREEPANWAKYYHGSAEEQRLQRHFSYSDRIRYYWPHPKAAAAVDELMSLLDGVAIP-ETLISQFLAG---SYARVRN 398
gi 504050180 323 TEMLSEPKYWRSHYQGSDHELRLLRHFSYADRIRYYWPQEKVQDALEALFAALQTHKIP-ETLLLQLFASqtvERARALQ 401
gi 505314522 311 TAMLDDPRYWQSHYQGDAEQLLQQRHFGLADRIRYYWPVPSVQAAVQQLVVDLPRQ-IP-DPILWQVFGQpvlDRAEDLA 388
gi 500132969 321 QLMQAEPQHWRKHYSGDARALRLLRHFGYADRVRYYWGQPAAKSAVAQLMQLLAEQPEPlAPLLAQHFADpvlEGAQTLQ 400
gi 489715435 324 KLMLREPEYWQRYYHGSDQALRIQRHFSYSDRIRYYWTHPDAMAAVSRLFAVLEDVAIP-ETLISQYLAR---VYPQVMS 399
gi 500075053 322 AVMLEAPGNWDRYYHGPEAERALQRHFSYSDRIRYYWPQPGAERAVDELFALLDGVELP-ETLIAQYLGG---LYPEVRA 397
gi 494976432 325 RIMLSSPEHWLKYYPGDAHEQYVQRHYSFSDRIRYYWAVPAAQKAVDELMAALQGVTIP-RPLISQHLGH---LESLVAD 400
gi 500733685 324 ALLLAEPKNWEKYYHGDAEELRLQRHFSYSDRIRYYWPHPVATAAVDALLNRLEGRKIP-ETLISQYLGT---LYPAVAS 399
gi 502084123 322 RLMLREPANWQKYYHGDATELRIQRHFSYSDRIRYYWPHPEAQAAIKRLLSFLQGRTIP-ETLISQYLEG---LYPAVAS 397
                        410       420
                 ....*....|....*....|....*..
2FIQ_A       393 GELSAIPHQLIXDKIYDVLRAYRYGCA 419
gi 81812087  399 GEVAPQAKPLALAAVDAVLQDYFAACR 425
gi 504050180 402 SYGFGIEKALVLAEIQQALDPYfferv 428
gi 505314522 389 G---SQIERLVRAQIQIALDPYffdps 412
gi 500132969 401 SQGFAWPQALVLAQIQAALNPYFLApq 427
gi 489715435 400 GQLVPAPRELVIASVQQVLAEYAVAVg 426
gi 500075053 398 GRLPPRARDLALAAVERLAQDYVAACC 424
gi 494976432 401 GSVAPQARALLLASVTRVLDIYADAId 427
gi 500733685 400 GEIEATPHALMVEAVRNVVRTYGKAVg 426
gi 502084123 398 GQVSADAISLQLASVRRVLGIYARACR 424
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap