Conserved Protein Domain Family
DUF1704

?
pfam08014: DUF1704 
Domain of unknown function (DUF1704)
This family contains many hypothetical proteins.
Statistics
?
PSSM-Id: 311807
View PSSM: pfam08014
Aligned: 50 rows
Threshold Bit Score: 365.379
Threshold Setting Gi: 503259351
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123532302  42 QQFFDSGFKKAPQVDIEyyqkncPLGFDPAAKKAEFYEIEREISKKlgqmNPVTQIMRRVCREYQMVVRMLEARGTP--E 119
gi 81397854  323 RRFLHNPYSYQPQFTYR------QLDLDPYKFREQLYRLPVEDIRD----ADIQKLYRKVIDQLAIRIDLLTNIGTD--E 390
gi 81543665  280 KRFEAAPSRYKPEFRYK------QLPINANEFKQQLYQLPIETISD----PDLKQLYGSMVDKLSEKIDLLTSIGQE--S 347
gi 81756293  329 KRFEAAPNRYTPDYRYR------QLPIHANEFKHQLYRLPIETIAD----PDMRQLYSDMVNNLSEKIDLLTSVGQE--A 396
gi 500193490 324 RRFMKAPSRFKPNFAYR------QLPIDANEFKYRLYRLPIDNIAD----PALKQLYKDIVNKLGEQIDLLTSVGQE--G 391
gi 505215750 322 KRFFAKQCSYTPQFRYR------QLKIDPFAFRKKLYAIGVDTIQD----VSIRQLYRSTIDMLAQKVDLLTTIGTD--S 389
gi 503072078  47 HRFFASKYTENPQFNYP------TLKFNPYKLHRLFFSQRLERIKD----EHIKKLYQQVIYYYSNMIQCIETIGTPr-R 115
gi 506235117  47 HRFFASKFTEEPQFKYP------KLKFDPYKLHRLFFSHRLDRIED----PVIRDMYKEVIYFYANMVQCIETIGHGk-R 115
gi 753802178  46 QRFFASKYTEDPILKYP------KVKFHPYKLHRMFFSQRLERIED----QRVQKLYQDIIYYYSNMVQCIQTIGEPk-K 114
gi 505176590  46 KEFFKSKYTHEPKFKYR------KLKFKPYKLHRMFFSQRLERIED----EDIRSLYKDIIYTYSGLVQCIETISESnsK 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123532302 120 FSYISQELYGSPSDafhagdpTLAELGEMMEMTLANlLKDSSMQESEKSLPAQYVVDELNARLSNFfvGAGIRVMISDGI 199
gi 81397854  391 FLYNSLRYYGQPDE-------RDIANANFILHA------CEYQEPPEATISAAEAIQAFKDAADDY--GITCKVVGSKQL 455
gi 81543665  348 FLYNSLRFYGRPNR-------TAIENAKFLLYA------KTLPEEKGELYNADQAAEIMLKKAQEW--GMHCHITPTASL 412
gi 81756293  397 FLYNSLRHYGRPDG-------VDISNAQFLLYA------QTLDEEHGALFTAQQAQTQMQQAAKGW--EMPCKVSLSSSL 461
gi 500193490 392 FVYNSLRYHGRPDK-------SAIANAKFLLYA------KEIPEERGESLDAHQVCEMMKQSAEQW--QMRCKIGLSGAI 456
gi 505215750 390 FLYNSLRFHGEPSE-------ADIELARFLIAA-----PPIEKEKNPKLLSARECANVFKRAENDY--GFSFQVELSSRI 455
gi 503072078 116 FYYNSLGVFGTPTE-------KDVQNARFILHF----PDEPTSSDMEKIYSAEEAKSYFEAFSKQY--DFPLNIKFATHL 182
gi 506235117 116 FYYNSLRVYGTPTE-------KDVENARFILHF----EDEPAFGNMEKRHSPEAARAYFEKFAKQY--DFPLDIRFSTHI 182
gi 753802178 115 FYYNSLRLYGTPTE-------KDVQNAQFILHH----SNEAERADMEKIYSPDDAKSYFEEFSKLY--DFPLNIKLSTAI 181
gi 505176590 116 FYFNSLRFFGTPTE-------KMVENAKFILHFQNE---ELVEKKHDAILSTEEAEAFFINYRELY--DFDFTIKTSSAM 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123532302 200 AADAAAG-TDY--IKIRNDALFNQQDVDVLEVHEGWVHLGTTLNGGSQPyCTFLSKGPPSATITQEGLAVLSEILTLRSG 276
gi 81397854  456 IARAMVS-GRS--IKVNTGCMFSQRDLDALIHHELGVHLVTSVNADAQP-LKVLKLGLPGNTHTQEGLAILCEFLSGSFP 531
gi 81543665  413 AARAMVSgKKPptLYLNSKVMYSHAEIQRLIQHEIGVHLATTFNGRMQP-LRVFSIGLPGATESQEGLAILAEYKAGYMS 491
gi 81756293  462 AARAMVS-SNPptLLLNGKVTFHDTELRRLIQHELGVHMATTFNAKMQP-LQVFRLGLPGDTLTQEGLAIMAEYHSGYLS 539
gi 500193490 457 VARAMVC-SNPaqLAISTHAQFHESEVQRLIQHELGVHMATTLNAKQQS-LKVLRLGLPGSTYTQEGLAILAELKAGFMA 534
gi 505215750 456 VARAMVS-SGRrkVMINRNAQFTEVEIQALIHHELGVHMVTTSNARQQY-LKIFRMGLPGNTETQEGLALLSEYLSGNLT 533
gi 503072078 183 SAEAMVS-NSSqtLLLKKNTKFSKNQLLTLANHEIGVHLVTTFNGALQP-LQIFSNGFPKNVETQEGLAVFSEYMGGALT 260
gi 506235117 183 AAEAMVS-NSSrsLLIKRNARFSDNQLLTLAHHEIGVHLVTTFNGLAQP-LKIFSNGLPKNVETQEGLAVFSEYMGGALT 260
gi 753802178 182 AADAMVS-NSTqtLLIKKNTKFSKNQLLTLANHEIGVHLVTTYNGIEQP-LKIFSNGFPRNVETQEGLAVFSEYMSGALT 259
gi 505176590 184 SAAAMVS-NKDrsLILKKGHLYSQHELNVLAHHEIGVHLVTTFNAIDQP-LKIFSNGFPNNVETQEGLAVMSEYMSGNLT 261
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123532302 277 PTRLFKLINRVRAVTLAEDGATFNDVFHYLCEK-GISEDESFTLAARVFRGStpnlgPFAKDITYIKGFVLTYNFLRLAf 355
gi 81397854  532 LHRLKTLALRVIAVDMMVNGDSFGTTFNALKHVhKLSDDDAFTITMRAYRGG-----GFTKDFLYLRGLKDAIHAYKQ-- 604
gi 81543665  492 HERLKTLATRVLAVDSMLKEHNFYQTFSYLTEEyGVDRESAFVTTTRVYRGG-----GFTKDHLYLEGFINTLQQAQK-- 564
gi 81756293  540 HARLQALAVRVLAVDSLLKEHNFYQTFCFLTDElQLERDDAFIITTRVYRGG-----GFTKDYVYLKGFLAMLDLSKQ-- 612
gi 500193490 535 HSRLNTLAARVLAVDSMLKEQDFYLTYSYLIDElEMDKDDAFMTTARVYRGG-----GFTKDHLYLSGFLDMLHLSKT-- 607
gi 505215750 534 LARLQSLAHRVMAVHMMVKNYDFPRTFKALSDDyGLSREDAFNLTVRVYRGG-----GFTKDYLYLTGLRKALQLYRSG- 607
gi 503072078 261 LKRLKELSYRVLASDSLIKGYSFSDTFDMIHNQyKLNREEAFTITLRAHRGG-----GFTKDRLYLSGLRKIYKRYLKE- 334
gi 506235117 261 LKRLKEISYRVLASDSLSKGYSFADTFDLIHNQyKLDRDAAFTITLRAHRGG-----GFTKDRLYLSGLRKIYKRYLRE- 334
gi 753802178 260 LNRLKTLAYRVLASESLIKGYSFSDTFDLIHGTyKLNRNDAFSITMRVHRGG-----GFTKDRLYLSGLKKIYKRYQKG- 333
gi 505176590 262 LNRLKELAYRVIATDSLIKGYSFADTFDLIHSQyKLDRERAFNITLRTHRGG-----GFTKDALYLSGLKKIYDLHKSN- 335
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 123532302 356 argkiDRLPMLFCGKIVLDDLASLHDLEEQGVITAPRY-VPPFFQDLKGLAAWMSFSRFIGQ 416
gi 81397854  605 -----GDLTSLFVGKTGFESKSLLDELIAREILKKPTY-IPKALSIKKEPNPVMDFLINSIK 660
gi 81543665  565 -----RSLDNLLVGKCSYQYLDLIDELVERGWLIKPRF-RFD--DLGSEPEPTLKYLIESLr 618
gi 81756293  613 -----RSLDNLMIGKCSHRYLDLIDELVERGWLTQPRH-RIP--QHQGDIEPTLAYLIRSLk 666
gi 500193490 608 -----RSLDNLLVGKTSVQYLDLLDELVQRDWLVPPKYnVIP--TSNLEESPSLNYLIESlr 662
gi 505215750 608 -----TDLQPMFVGKTSIAFLDTLKEMLGRDVVSNPLH-LPRAWQMKVQSSPILDYLLSsfg 663
gi 503072078 335 -----DSMDSMLTGKVTLEFEDSIKYLQHLGLATTITH-KNIAYSQNLNTNKTLDFILNNLK 390
gi 506235117 335 -----ESMDRMLTGKVALDFEKQIAYLQDIGLAVKGPH-DCLSFRDKRNTNPTLDFILNNLK 390
gi 753802178 334 -----EAMDNLLTGKVTMDYEADIVNLQELGLANPITH-KNIAFMENKNENKTLDFILNNLK 389
gi 505176590 336 -----TNFDNMLLGKCSLEYNPIIEKMKGLNLVLPAAH-HAKSFDVQLNNNPTIDFILNNLK 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap