Conserved Protein Domain Family
Fibrinogen_BP

?
pfam08017: Fibrinogen_BP 
Fibrinogen binding protein
Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.
Statistics
?
PSSM-Id: 311808
View PSSM: pfam08017
Aligned: 3 rows
Threshold Bit Score: 418.499
Threshold Setting Gi: 75447376
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75447376  18 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQGNVLERRQRDAENKSQGNVLE 97
gi 75446120  18 YMGVLGSTIILGSSSVSAMDSVGNQSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLE 97
gi 81588819  18 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLE 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75447376  98 RRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLE 177
gi 75446120  98 RRQRDVENKSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLE 177
gi 81588819  98 RRQRDAENRSQGNVLERRQRDVENKSQGNVLERRQRDAENKSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQGNVLE 177
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75447376 178 RRQRDVENKSQGNVLERRQRDAENKSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLE 257
gi 75446120 178 RRQRDAENRSQGNVLERRQRDAENKSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLE 257
gi 81588819 178 RRQRDAENRSQGNVLERRQRDVENKSQGNVLERRQRDVENKSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQGNVLE 257
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75447376 258 RRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGnvlerrqrdaenrsqgnvlerrqrdaenrsqgNVLE 337
gi 75446120 258 RRQRDAENKSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQG--------------------------------NVLE 305
gi 81588819 258 RRQRDVENKSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQG--------------------------------NVLE 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75447376 338 RRQRDAENKSQVGQLIGKNPLLSKSIISRENNHSSQGDSNKQSFSKKVSQVTNVANRPMLTNNSRTISVINKLPKTGDDQ 417
gi 75446120 306 RRQRDAENKSQVGQLIGKNPLLSKSIISRENNHSSQGDSNKQSFSKKVSQVTNVANRPMLTNNSRTISVINKLPKTGDDQ 385
gi 81588819 306 RRQRDAENKSQVGQLIGKNPLLSKSIISRENNHSSQGDSNKQSFSKKVSQVTNVANRPMLTNNSRTISVINKLPKTGDDQ 385
                       410       420
                ....*....|....*....|....*
gi 75447376 418 NVIFKLVGFGLILLTSRCGLRRNEN 442
gi 75446120 386 NVIFKLVGFGLILLTSRCGLRRNEN 410
gi 81588819 386 NVIFKLVGFGLILLTSRCGLRRNEN 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap