3AFE,4U83


Conserved Protein Domain Family
Acyl-CoA_dh_2

?
pfam08028: Acyl-CoA_dh_2 
Click on image for an interactive view with Cn3D
Acyl-CoA dehydrogenase, C-terminal domain
Statistics
?
PSSM-Id: 311812
View PSSM: pfam08028
Aligned: 22 rows
Threshold Bit Score: 81.9789
Threshold Setting Gi: 81720214
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3AFE_C       240 TISAPIVGMAYGAYAAHVEHQG-KRVRaAFAGEKAKDDPFAKVRIAEAASDIDAAWRQLIGNVSDEYALLAAGKEI-PFE 317
gi 81571331  242 GHASWALGVAKSMLDDVQELAA-TKFR-MSDMASLASRPTFQKGLAHHRAAWRAARLLVLDAFTTAEAAVAAGQEL-TPA 318
gi 81592061  241 SIAAVALGIAHRAIESLIDLSK-QKTP-QGSTRPLAERSGTQLAIAYCSARLRAARAFLHEVLEDTWAVSKGSDPI-AVS 317
gi 81736210  247 VHGAFVVGMAESTVDELLALANtGRQQ-LYAAVPMRESEIFQYELGRISAELGAAQAFHEVQAASHWRHALAGTLN-DED 324
gi 81555716  224 SIGAAALGNARAAIDDLVELAG-GKKG-LGSTRTLAERSATQAAAATAESALGAARALFYEVIEAAWQVSHDAEAV-PVT 300
gi 81592076  250 SVAAAALGFARRALDEALARAT-TRKM---FNGVLADFQLTQAKLAQMATAIDSAALLTYRAAWQ----RDQGRSV---- 317
gi 81580950  244 GIGAQALGIAEAALACAIDYAK-EREQ---FGKPIAEQQGIGFKLADMATSVEAARLLVYRAASL----RAQGLPC---- 311
gi 123754482 243 GIAAQAVGMARAAFEAARDYAR-ERIT---FGKPIIEHQAVAFRLADMATRIETARQMVLHAAAL----REAGKPC---- 310
gi 81735796  263 VLSGVALGNAQACLNDYIEVVR-HRIS-TYNRAKLSDFQSTQIKIAEASAKIDAARRTMRSACIDAME-DARRSHIpDMA 339
4U83_A       250 GIAAQAVGMARAAFEAARDYAR-ERIT---FGKPIIEHQAVAFRLADMATRIETARQMVLHAA----ALREAGKPC---- 317
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
3AFE_C       318 LRARARRDQVRATGRSIASIDRLFEASGATALSNEAPIQRFWRDAHAGRVHAANDP 373
gi 81571331  319 LRADMRVAAVYATDTARGCAEWAHLVAGTSSIREGSRLERAFRDIYTGTQHAFISE 374
gi 81592061  318 HRRDIRLAATFATTESASVVDRMHRLAGGSAVYQASPIQRCLRDIHVATQHIMVSE 373
gi 81736210  325 LVVEGTRSATWLATTCVGIADACFSLAGSSAVYDSSPLQRRLRDLHVAAQHAHAQQ 380
gi 81555716  301 MRNRLRLAATHAVRTSADVVRSMYDLAGGTAIYDNAPLQRRFRDAFTATAHFQVNe 356
gi 81592076  318 -TREAAMAKMTATENAQQVIDAAVQMWGGLGVVSEQPVERLYREIRALRIYEGATE 372
gi 81580950  312 -GKEASIAKLFASKTAVEVAIEAVQVFGGYGYTKDYPVERFFRDAKITQIYEGTSE 366
gi 123754482 311 -LTEASMAKLVASEMAEQVCSAAIQIHGGYGYLADYPVERIYRDVRVCQIYEGTSd 365
gi 81735796  340 TKTRYRRDGAFSVNLCTDAVSMLFAASGARGLFTAGVLQRQFRDAHAINSHLAFNF 395
4U83_A       318 -LTEASMAKLVASEMAEQVCSAAIQIHGGYGYLADYPVERIYRDVRVCQIYEGTSd 372
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap