Conserved Protein Domain Family
Sec23_BS

?
pfam08033: Sec23_BS 
Click on image for an interactive view with Cn3D
Sec23/Sec24 beta-sandwich domain
Statistics
?
PSSM-Id: 311817
View PSSM: pfam08033
Aligned: 139 rows
Threshold Bit Score: 57.5385
Threshold Setting Gi: 123492738
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EFO_B       424 GFDAIMRVRTSTGFRATDFFGGILMN--------N-----------TTD--VEMAAIDCDKAVTVEFKH-----DDK--L 475
gi 121958603 364 KYCYSIEVYCSKEIKPRSCIGHVTTSenk--egySsllslpeefgvPGNk-FKTSTVDPHSSFVFLFDIvnpdtN-P--L 437
gi 75275798  510 GSHGLFEIRCSDDMLVTQVIGPGEEA--------Spdshe--tfkhDTSfcIQMHSVEETQSFSVSMES-----KGD--I 572
gi 75036127  415 GFAVRMEVNTSVGTLLRGALGPCNVDveankrgpTrltsp-levgaGGTtrWCVSYLDKGMTLSFLFDTatasnQQSgaA 493
gi 122016926 384 GLNVTMDVITSTTWKVMGVIGQCVGTgk----ksSsvaey--evgmGGTcqWTACMMDCTTNFAIYFDTtaahpS-E--A 454
gi 122112116 384 ALNVTMDIITSPSWKVMGVIGQCVGTgk----ksSsvads--eigmGGTcqWTACMMDSTTNFAIYFDTm---tVPE--A 452
gi 123492738 379 GSEAIVTINGSSHLNVTGMIGCGIANppv---nnFfsinn--kvglSGTdqWRIVGLRRGTSLGIFLDSk--------gG 445
gi 146102572 488 GLNATMDVITSPTWKVQGVIGPCVGTgk----msAsvaey--eiglGGTcqWTTCQLDSTTTFAIYYDTastqsN-E--A 558
gi 123431750 389 GAEVQTQIICSNNFKISGCIGPCSPKet----pgPavsek--qigiGGTtsWSLGGALPSTTLAFYFDItaskaD-P--V 459
gi 123496425 382 GLNGTLQVACSKGLAIRGVVGPCLSNkv----vnPsvsqn--vvgeGGSvqWHVAGILPNTTFAIFFETanpksN-P--V 452
                         90       100       110
                 ....*....|....*....|....*....|....
3EFO_B       476 SEDSGALIQCAVLYTTI-SGQRRLRIHNLGLNCS 508
gi 121958603 438 DSNRQGIIQLVSKYMDT-LGRRYIRVTTICRLFT 470
gi 75275798  573 KN-DFVYFQFAVHYSNM-YQTEITRVITMRLQTV 604
gi 75036127  494 SAYEKRFIQFVTRYTTP-RGEQRVRVTSVVQPVA 526
gi 122016926 455 AKRSVRYAQFITKYEI--GNEVRTRVCTVTHQAQ 486
gi 122112116 453 QKQPFRYVQFVTKYEI--GRETRVRVCTRKHVVQ 484
gi 123492738 446 VNGEKCFIQLLCRYRYFvTGKTHLRVTTAAVSFD 479
gi 146102572 559 AKNPLRYTQIVTRYEM--GQETHTRVTTLTLRQA 590
gi 123431750 460 PVGTTAFIQFVTTYRNVlSGQYVRRVTTTAVNFG 493
gi 123496425 453 PANSSGFIQLTLKFRSLyNGSEKLRVSTFPVNFL 486
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap