Conserved Protein Domain Family
Attractin

?
pfam08037: Attractin 
Click on image for an interactive view with Cn3D
Attractin family
This family consists of the attractin family of water-borne pheromone. Mate attraction in Aplysia involves a long-distance water-borne signal in the form of the attractin peptide, that is released during egg laying. These peptides contain 6 conserved cysteines and are folded into 2 antiparallel helices. The second helix contains the IEECKTS sequence conserved in Aplysia attractins.
Statistics
?
PSSM-Id: 311820
View PSSM: pfam08037
Aligned: 3 rows
Threshold Bit Score: 39.1718
Threshold Setting Gi: 49259245
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*
1T50_A       4 CDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCqnQEFESAAGSTTLGPQ 58
gi 47115553  4 CDIEFATSECEMRYQDCGEASSCTALIEECKTSLQEEC--NQASSDESSTTVRPE 56
gi 38257306 22 CDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCqnQEFESAAGSTTLGPQ 76
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap