Conserved Protein Domain Family
UME

?
pfam08064: UME 
UME (NUC010) domain
This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1.
Statistics
?
PSSM-Id: 336914
View PSSM: pfam08064
Aligned: 131 rows
Threshold Bit Score: 52.5017
Threshold Setting Gi: 953473835
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1160421745  850 LIEDQVLLLVQKFSDVThSSRGAKPYLELKNSFYAIEFLIKGHIDAITSALGQLS-----------------TCLQATLE 912
gi 336373879   477 FLKDHMLGIISDMNDTLqDVLGKKSISEKRQILRSIGALIGHIGPAINSVSPQIM-----------------AMLQTMFL 539
gi 449549539   473 FLRSYMLGVITHINDMLqDVQGKRPIEAKKRIIKSLGPFMTEVGPGVSHVAPQIM-----------------ATLQTMLP 535
gi 215472508   132 FLKSYILGLITTINDMLqDVHGKKSIETKRMIIRSLGVLVEEVGPGISSVAPQIM-----------------ATFQTMAC 194
gi 568442725   466 FLKVHMLGLMSYINEMLqDMQGKKSVASKRKIIKGLGELIVQIGPNISYGAPQVM-----------------ATFQTMVN 528
gi 443917690   876 FLTNHLLGIVMHINDALqDVRGKATVSQKIQMIKSLGVVVKSVGASSSLVSPQIM-----------------ATLQSMIR 938
gi 527297949   481 FLSPHVLGIIAGINDQLq--FSKRTVESKRAIIRSIGGFAREMGSLISLAAPQIM-----------------TTLQTMLV 541
gi 302693825   430 wLKNKMLGVISCVGNMLqDKSGKKTAEQKRMILRGLGAFISRVGPAIRHIAPQIM-----------------ACYQSVIS 492
gi 299748269   818 FLATQMLGIMSKIIDTLqDVHGKKSVEAKEQIIRSIGVFISLVGPPIHSLSSQIM-----------------AIFQTSLS 880
gi 353242301   601 FLQQHIMAIVTHLNNELqDVHGKRSVDTKQWVLYGLRRVMMLIGESIAVVAPQVSfssyrsyqganisqklvAIMQNTIR 680
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 1160421745  913 EPNFHVLSLRCWNELIKKVPPSHLISLIDIIISIILQKF 951
gi 336373879   540 IPELSEVTLATWFTFLSTLEPNEVGPHVGPTSASFISSW 578
gi 449549539   536 IQELVDATLESWFTFLTTLERRDIGPHVGPTSAAFVAFW 574
gi 215472508   195 IPDLADATLTSWHCFLVTMSPEEVGPHIGPASAVFMAFW 233
gi 568442725   529 VPELSEVTLQSWHKFLTTLEPGEVGPHVGPTSAAIVTAW 567
gi 443917690   939 IPELSEATLSTWHSFIETLLIVDAVSLLGVTTATVVRHW 977
gi 527297949   542 NPDFTDVTLRSWREFLATLDVQDLGPYVGPTSAFFVMKW 580
gi 302693825   493 APELTEATLESWLIFLQTLEWADIGEVVGTTSSTFVLNW 531
gi 299748269   881 VAELAEVTLESWHEYLVTIDSKDLGPHLGSTCSAFVSAW 919
gi 353242301   681 IAGLTSVTVEVWQEFASIMSISDFGPYVPLTSAIFVASW 719
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap